KEGG   Marinobacter sp. LQ44: ASQ50_05935Help
Entry
ASQ50_05935       CDS       T04470                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ASQ50_05935
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mlq02000]
    ASQ50_05935
Enzymes [BR:mlq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ASQ50_05935
Transporters [BR:mlq02000]
 Other Transporters
  Pores ion channels [TC:1]
   ASQ50_05935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AMQ88271
UniProt: A0A142FP62
LinkDB All DBs
Position
1269158..1269826
Genome map
AA seq 222 aa AA seqDB search
MITVHHLNNSRSQRVLWMLEELGVPYEIQRYERDAETMLAPASLKQVHPLGKSPVITDGD
LVVAESGAIIEYLAHTYGKDSMLPENGGQQWLDYTYWMHYAEGSLMPPLVMRLVFEKVKT
SPMPFFIRPVAKGIADKTNQIFIGPMIKTHLDFVEAHLAKNTWFLGDELSAADIQMSFPL
EASVARGIVGASRPHISAWVARVHARPAYQRALEKGGEYDFA
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgattacagtccaccacctcaacaactcccgctcacaacgggttctctggatgctcgaa
gaactgggcgtaccctatgaaatccagcgttacgagcgcgacgctgaaaccatgctggcc
cccgccagcctgaaacaggtacacccgctggggaaatcaccggtgattaccgatggtgat
ctggtggtggcagaatccggcgccatcattgaatacctggcccacacttacggcaaagac
agcatgctgcccgaaaacggcggccagcaatggctggattacacctactggatgcattac
gccgagggttcactgatgccgccgctggtcatgcgcctggtatttgaaaaagtgaaaacc
agcccgatgccgtttttcatccggccggtggcgaaaggcatcgccgacaaaacgaaccag
atattcattggccctatgatcaaaacccatctggactttgtcgaagcccacctggcgaag
aatacctggtttctgggggacgaactgagcgcagccgatatccagatgagcttcccgctg
gaggcctcggtggcacggggtattgtgggtgcaagccgcccgcacatttctgcctgggtg
gcgcgagtacacgcccggccggcttaccagagggcccttgagaaaggcggcgagtacgac
ttcgcctga

DBGET integrated database retrieval system