KEGG   Marinobacter sp. LQ44: ASQ50_10800Help
Entry
ASQ50_10800       CDS       T04470                                 

Definition
(GenBank) alpha-amlyase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00500  Starch and sucrose metabolism
mlq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ASQ50_10800
Enzymes [BR:mlq01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ASQ50_10800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: AMQ89140
UniProt: A0A142FRN1
LinkDB All DBs
Position
2335157..2336893
Genome map
AA seq 578 aa AA seqDB search
MISLSRLATGTALGLALTLPTQQAQAGAFVHLFEWTWSDVAQECENFLGPKGFSAVQVSP
PQEHIQGSAWWTRYQPVSYQLNSRSGDASAFADMVQRCNAAGVDVYADAVINHMANGSGT
GTAGSTYSSSTLSYPIYSSNDFHTPCGINPEDYGTDAWRVRNCQLVGLPDLNTADNYVQN
TLAGYLNQLTALGVKGIRIDAAKHMSPSDISGILTRVNNPLYVFQEVIDLGGEAVSAGEY
TGLSDVTEFRYSAAIGDVFKNQRLANLIGFGESWGFLAGGDAVVFTDNHDNQRGHGAGGS
NIVTYKDGGLYNLANVFMLAWPYGYPKVMSSYSFSDGDQGPPAQTVYQNGSAQCGSAWIC
EHRWDSIANMVAFRNVTDGSGVSHWWDNGNNQIAFSRGNKGFVAINREGSTLSRTFTTGL
PDGSYRNVAGDGSCVTVQGGQVTLSVVSMEAAALHVGADCDGNDGSGDGNNGNGSEGEQA
NVAFQCSNGTTNWGQSVYVTGNNAALGNWSPANALRLDPTNYPTWSGSFDMPANSQVEWK
CIKRSESDPDAQLVWQSGANNQVQTGAAGSSASASGSF
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgatctcactctcccgattggcaaccggtaccgcgctcggactggcactgacattgcca
acacagcaggcccaggccggtgcctttgtgcatctgtttgaatggacatggagcgacgtc
gcccaggaatgtgaaaacttcctggggcccaaagggttcagtgcggttcaggtatcgccg
ccccaggagcacatccagggcagtgcctggtggacccggtatcagccggtgagttatcag
ctgaacagccgcagcggcgatgccagcgcgtttgccgacatggtccagcgttgtaacgcc
gccggcgtggatgtgtacgccgatgctgtgatcaaccatatggccaatggcagtggtacg
ggcactgcgggttcgacgtacagttcaagcaccctcagttatcctatctacagcagcaat
gattttcatacgccttgcggtatcaatccggaagattacggcaccgacgcctggcgtgtt
cgaaactgccagctggtggggctgcccgatctcaataccgcagacaactacgttcagaat
accctggccgggtacctgaaccagctgacagcgcttggtgtgaaaggcattcgaattgac
gccgccaagcacatgtcgccctcggatatcagtggcatcctgacccgtgtgaacaaccca
ctgtatgtattccaggaagtgatagacctgggcggtgaggcagtgagcgccggtgagtat
accgggctttccgatgttaccgagttccgctacagcgcggcgattggcgacgtgttcaag
aaccagcgcctggcgaaccttatcgggtttggtgaaagctggggattcctggccggtggt
gatgccgtggtgtttaccgacaaccacgacaaccagcgcggccatggcgccggtggcagc
aatatcgttacctacaaggatggcggcctgtataacctcgccaatgtgttcatgctggcc
tggccctatgggtatccgaaggtgatgtcgagttacagcttttcggatggcgaccagggg
ccacccgcccagacggtttatcagaatggaagcgcgcaatgcggcagcgcctggatatgt
gagcaccgttgggattccattgccaacatggtggctttccgcaatgtgacggatggttcc
ggcgtcagccattggtgggataacggcaataaccagatcgccttcagccgtggcaacaag
ggctttgtggccatcaaccgggaagggagtaccctgtctcgaacgtttacaaccggcctg
cccgatggcagctatcgtaacgtggccggtgacggcagctgtgtcaccgtgcagggcggg
caggtgaccctgtcagttgtgtccatggaagccgcggcgctgcatgttggcgcagactgt
gatggcaacgacggctccggtgacggaaacaacggtaacggttcagaaggggaacaggcc
aacgttgcctttcagtgcagtaatggcaccaccaactggggccaaagtgtctacgttacc
ggcaacaatgccgcgctgggcaactggtcgcctgcgaatgcgctgaggctggatccaacc
aattatccaacctggtccggcagcttcgacatgcctgcaaactcgcaggtagagtggaag
tgcatcaaacgcagcgagtcagacccggatgcccagctggtgtggcaaagcggcgccaat
aaccaggtgcaaactggtgcggctggctcatccgccagcgcgtccggtagcttctga

DBGET integrated database retrieval system