KEGG   Marinobacter sp. LQ44: ASQ50_11250Help
Entry
ASQ50_11250       CDS       T04470                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mlq  Marinobacter sp. LQ44
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ASQ50_11250
Enzymes [BR:mlq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ASQ50_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 FAD_binding_2 GIDA HI0933_like FAD_oxidored DAO AlaDh_PNT_C K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AMQ89225
UniProt: A0A142FRW6
LinkDB All DBs
Position
2435570..2437135
Genome map
AA seq 521 aa AA seqDB search
MLDANIKGQLKAYMEKLQQPIELVAAYDDSKKSQELKQLLEEIEPMSEKISLRTEDSADV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQEVIQQIQELDGEFE
FETYFSLSCQNCPDVVQAFNLMSVLNPNIKHTSIDGALFQNEVEQREVMAVPSVYLNGQP
WGQGRMTLEEVVAKLDTNSAEKEAKKINQKDAFEVLVIGGGPAGSAAAIYAARKGISTGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVNEYEVDIMNMQRAEKLIPAAQTG
GLHEVKLANGGSLKARTVILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGEQMRADEVLQKKLRSLNNVKIITSGQTTEVVGT
DGKVSGLNYTDRTTGESHHVELEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSAE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatatcaaaggacagttgaaggcctacatggaaaagctgcagcagcct
attgagctggtggcagcctacgacgacagcaaaaagtcccaggagctgaagcagctgctg
gaagaaatcgagccgatgtccgagaaaatcagcctgcggactgaagattcggctgatgtg
cgccgtccgtcgtttgccatcaaccgtgtgggcactgacattggcgtgcgtttcgccggt
attcccatgggccacgagtttacctctctggtccttgcgctgttgcaggtgggcggccac
ccgtccaaggcttctcaggaagtgattcagcaaatccaggaactggacggtgagttcgag
tttgaaacctatttctccctgtcctgccagaactgcccggacgtggtgcaggcttttaac
ctgatgagtgtgctgaacccgaacatcaagcacacctccatcgacggcgccctgttccag
aacgaagtcgagcagcgtgaggtaatggcggtgccgagcgtgtacctgaatggccagccc
tggggccagggccggatgacgctggaagaagttgtggccaagctggacaccaactcggcg
gagaaagaagccaagaagatcaaccagaaagacgcctttgaggtgctggtgatcggcggt
ggcccggcgggttctgcagcggccatctacgccgcccgtaaggggatttcaaccggtatt
gcggccgagcgctttggtggccaggtagcagacaccatgggtatcgaaaacctgatctcc
gtgccttacaccgaaggcccgaagctggtggcggccatggaacagcacgttaacgaatac
gaagtcgacatcatgaacatgcagcgcgccgagaagctgattccggcggcgcaaactggt
ggcctgcatgaagtgaagctggcgaacggcggttccctgaaagcccgcacggtgattctg
tctaccggtgcccgctggcgccagatgggtgtgccgggtgaggaagagtaccgcaacaag
ggcgtggcctactgcccgcactgcgacggcccgctgttcaaaggcaagcgcgtggcggtg
attggtggtggtaactccggcgtggaagcggcgatcgacctggccggtattgttggccac
gtaaccctgattgagttcggtgagcagatgcgtgccgacgaagtgctgcagaagaaactg
cgcagcctgaacaacgtgaagatcattacctccggccagaccacggaagtggtgggtacc
gatggcaaggtcagcggcctgaactacaccgaccgtaccaccggtgagtcgcatcacgtt
gagctggaaggcgtgtttgttcagatcggcctggtgccgaacaccgagtggctgaaaggt
gatattgagctgagccagcacggtgagatcatcgtaaatgatcgtaacgagacctcgatt
ccgggtgtgttcgccgctggcgatgccaccacggttccgtacaagcagatcgtgatttcg
atgggcgaaggttccaaagccgccttgagtgcctttgatttcctgattcgcaactccgcc
gagtaa

DBGET integrated database retrieval system