KEGG   Marinobacter sp. LQ44: ASQ50_12005Help
Entry
ASQ50_12005       CDS       T04470                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq03030  DNA replication
mlq03410  Base excision repair
mlq03420  Nucleotide excision repair
mlq03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    ASQ50_12005
   03410 Base excision repair
    ASQ50_12005
   03420 Nucleotide excision repair
    ASQ50_12005
   03430 Mismatch repair
    ASQ50_12005
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mlq03032]
    ASQ50_12005
   03400 DNA repair and recombination proteins [BR:mlq03400]
    ASQ50_12005
Enzymes [BR:mlq01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ASQ50_12005
    6.5.1.6  DNA ligase (ATP or NAD+)
     ASQ50_12005
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     ASQ50_12005
DNA replication proteins [BR:mlq03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    ASQ50_12005
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     ASQ50_12005
DNA repair and recombination proteins [BR:mlq03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     ASQ50_12005
   NER (nucleotide excision repair)
    Other NER factors
     ASQ50_12005
   MMR (mismatch exicision repair)
    Other MMR factors
     ASQ50_12005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AMQ89366
UniProt: A0A142FSA7
LinkDB All DBs
Position
2610193..2611083
Genome map
AA seq 296 aa AA seqDB search
MPLFTTGGVRAAALVLSLLILSLLASDPVKADARPPAIPLANVYHPGVNLEDYWVSEKLD
GVRAYWDGEQFWSRGGHVYPAPDWFTAQFPRQPLDGELWSGRGRFAELSGVVRKVQQVDR
EWRQVRFHVFDLPQPETVFEQRYRQLERLVAGSDSPYLVLVEQRPVASHDELKAQLEAMV
SAGAEGLMLKRRNSLYRAGRSDDLLKVKTHEDTEARVVGHLPGKGKYEGLMGALKVELYD
GRRFRIGTGFTDADRRNPPAIGSVITFRYRGLTATGLPRFASFLRVRNDEPVPKAD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccactcttcactaccggcggtgtcagggcagcagccctggtactcagcctgcttatt
ctctcgttactcgccagtgatccggttaaggccgatgcacggccgcctgccatccccctg
gccaatgtctatcacccgggtgtaaacttggaggattactgggtcagcgaaaagctggac
ggtgtccgggcctattgggatggcgagcagttctggtcccggggcgggcatgtatacccg
gcgccggactggtttacggcgcagtttccccggcagccgctggatggtgaactctggagt
ggtcgcgggcgctttgctgagctgtctggggtggtgcgcaaagtgcagcaggtggatcgg
gaatggcgtcaggtgaggtttcatgtgtttgatctgccgcaacctgaaaccgtgttcgag
cagcgctatcgtcagttggaacggctggttgcaggctctgactcaccgtatctggtattg
gtggagcagcgcccggttgccagccatgacgaactgaaagcacagcttgaagcgatggtc
tcagccggcgcggaagggttgatgctgaagcgcagaaacagcctgtatcgggctggtcgt
tcagacgatctgctcaaggtgaaaacccatgaggacaccgaagcccgagtggttggccac
ctgccgggcaagggcaagtatgagggcttgatgggtgccttgaaagttgagctgtacgat
ggccggcggtttcgcatcggaaccgggtttaccgatgcggacaggcgcaacccgccggcg
attggctcagtcattaccttccgctaccgtggtttgaccgccaccggcttgccacggttt
gccagctttcttcgagtccggaatgatgaaccggtgccaaaagccgattag

DBGET integrated database retrieval system