KEGG   Marinobacter sp. LQ44: ASQ50_12530Help
Entry
ASQ50_12530       CDS       T04470                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00250  Alanine, aspartate and glutamate metabolism
mlq00410  beta-Alanine metabolism
mlq00430  Taurine and hypotaurine metabolism
mlq00650  Butanoate metabolism
mlq01100  Metabolic pathways
mlq01110  Biosynthesis of secondary metabolites
mlq01120  Microbial metabolism in diverse environments
mlq02024  Quorum sensing
Module
mlq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ASQ50_12530
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASQ50_12530
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASQ50_12530
   00430 Taurine and hypotaurine metabolism
    ASQ50_12530
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASQ50_12530
Enzymes [BR:mlq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ASQ50_12530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AMQ89467
UniProt: A0A142FSK8
LinkDB All DBs
Position
complement(2736397..2738076)
Genome map
AA seq 559 aa AA seqDB search
MTGKKKSAQASVEAMYRVFTVPEAPESTLSRIDQNISRNLAGFLQEHIVAVERDLSDVEK
NFADSVIPEKPVFVSEQAQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPLERQVLGMIHRLVYQQDGSFYRKWMHDPRHALGAMCSGGTVANLTA
LWVARNRAFPAEGSFRGLHEEGLFRALRYYGCEGAAIVVSKRGHYSLRKAADVLGLGRDA
LVPVETDEFNRIQPDALRDKCLELQKQKIKVMAICGVAGTTETGNVDPLDAMADIAREFG
AHFHVDAAWGGPTLFSRTHKHLLRGIEKADSVTFDAHKQLYVPMGAGLVVFKDPSLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYEILIDQGIDKAKTFANM
IDEQPDFELVTRPELNILTYRYCPEDVRQALAMADELQAEKMNTCLNRITKFIQKTQRER
GKAFVSRTRLEPARYYHFPCIVFRVVLANPLTTPDILEDILEEQRELSWENGISDEMAVL
NQMAATVLTQNNRDKRANG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaagaaaaaatccgcccaggcctccgttgaggccatgtatcgcgtattcacg
gtgcccgaggcgccggaatccaccctgagccgcatcgatcagaacatctcccggaacctg
gccggcttcctccaggaacacatcgtcgccgttgaacgcgacctgagcgatgtcgaaaaa
aacttcgccgactccgtgattccggaaaagcccgtattcgtctccgaacaggcccagttc
ctgctcgacaaactggtggccaactcggttcacaccgcctcaccggcattcatcggccac
atgacctcggcactgccctacttcatgctgccgctgtcaaaaatcatgattgccctgaac
cagaacctggtcaaaaccgaaacctcgaaggccttcacccccctggagcgccaggtactg
ggcatgatccaccggctggtgtaccagcaggacggctccttctaccgaaaatggatgcac
gacccccggcacgccctgggcgccatgtgctccggcggcaccgtcgccaacctcaccgcc
ctgtgggtcgcccgcaaccgcgccttccccgccgaaggcagcttccgcggcctgcacgaa
gaaggcctgttccgggcactgaggtactatggctgcgaaggcgccgccatcgttgtctcc
aagcgcggtcactattccctgcgcaaagccgccgacgtactcggcctgggccgggatgcc
ctggtgccggtggaaaccgacgaattcaaccgtatccagcccgatgccctgcgggacaaa
tgcctggaactgcaaaagcagaaaatcaaggtcatggctatctgcggcgtggccggcacc
accgaaaccggcaacgtcgacccgctggacgccatggccgacatcgcccgggaattcggc
gcccacttccacgtcgacgccgcctggggcgggccaaccctgttctcccgcacccacaaa
cacctgctgcgcggcatcgagaaagccgactcggtcaccttcgacgcgcacaaacagctc
tacgtacccatgggcgccggtctggtggtcttcaaagaccccagcctcgccagcgcggta
gaacaccacgcccagtacatcatccgaaaaggttcccgggacctcggcagcaccaccctg
gaaggctcccgcccgggcatggccatgctgatccactcaggcctgaaaatcctcgcaaga
gaaggctacgaaattctcatcgaccagggcatcgacaaagccaaaacctttgccaacatg
atcgatgaacaaccggatttcgaactggttacccggccggaactgaacatcctgacttac
cgttattgtccggaagacgtacgccaggcactggccatggccgacgaactgcaggcagag
aaaatgaacacctgcctgaaccgtatcacaaaattcatccagaaaacccagcgggagaga
ggcaaggcatttgtctcccgaacccgactggagccggcccgctactaccacttcccgtgc
atcgttttccgggtggtcctggccaacccgttaacaacaccggatattctggaggacatt
cttgaggagcagcgagagctgtcgtgggaaaacggcatcagcgacgaaatggctgttctg
aaccagatggcagccacggtactgacccaaaataacagagacaaacgggctaatggctga

DBGET integrated database retrieval system