KEGG   Marinobacter sp. LQ44: ASQ50_16685Help
Entry
ASQ50_16685       CDS       T04470                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00620  Pyruvate metabolism
mlq00680  Methane metabolism
mlq01100  Metabolic pathways
mlq01120  Microbial metabolism in diverse environments
mlq01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ASQ50_16685
  09102 Energy metabolism
   00680 Methane metabolism
    ASQ50_16685
Enzymes [BR:mlq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ASQ50_16685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMQ91048
UniProt: A0A142FX39
LinkDB All DBs
Position
3631538..3634144
Genome map
AA seq 868 aa AA seqDB search
MLGELLGQSIQRFPGQDCYERIEEIRAAAKADRRQESGSGQRLVTLLGQLSDDELLPVTR
AFNQFLNLANLAEQYHGIRRKQGHPSDLMVESLGEVFERLKSGGVDPEELHQRVADLRIE
FVLTAHPTEVARRTLILKYDEMSDCLARLDHDDLMPAERDEIVARLSRLITEAWHTDEIR
HERPTAVDEAKWGFAVIENSLWQALPRFLRSLDQSLSDATGKGLPLQNSPIRIASWMGGD
RDGNPNVTHDVTRQVFLLGRWMAADLYLRDIQALRAELSMWQASDELRARVGDCREPYRQ
VLAELRERLVRTRDWAEAGVKGLVADETGILFENEDLTAPLELCYRSLMDCGLEQIANGP
LLDTIRRAHTFGLPLIRLDIRQEASRHAEAVAEMVDYLGLGDYLSWSEDDRQAFLLRELQ
GRRPLVPRNWEPSESVREVLATCEVVAGQTPEALGSYVISMASKPSDVLNVILLLREAGM
KFPMRVVPLFETLSDLQGAPDSMAALYQVDWYREYCQGRQEVMIGYSDSSKDAGQLMAAW
AQYQAQEKLTQVARQYGVHLTLFHGRGGTVGRGGGPANRAILSQPPGSVNGSFRITEQGE
MIRFKFGLPRLAVQSLTLYTTAVIEATLAPPPQPEDSWREMMDWLTERSLKSYREVVREN
PDFVPYFRQVTPETALGKLALGSRPARRKATGGVESLRAIPWIFAWTQMRLMLPSWLGSD
VALEEAARHQRLPELREMMRGWPFFRTYVDMLEMVLAKADLRIASYYEQTLVEDESLRAL
GGSLRERLNGCIERVLELKDQQALLESEPVFAHSMRVRNPYTDPLHYLQAELLKRDRESE
GKGEVPDMVERALKVTMAGIAAGMRNTG
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
ctgctgggcgaattgctgggccagagcatccagcgttttcccgggcaggactgctacgag
aggattgaggagattcgggctgcggccaaagctgaccgccggcaggagagtggctccggg
cagcgcctggtaacactcctggggcaactgagcgacgatgaactgttgccggtcacccgc
gccttcaaccagtttctcaacctggcgaacctggccgagcagtaccatggcattcgccgt
aagcagggccacccttccgacctgatggtagagtccctgggtgaggtcttcgagcgattg
aaatccgggggcgttgatcctgaggaattgcatcagcgggtggctgacctgcggattgag
tttgtactgactgcccacccgacagaagttgcccgccgtaccctgattctgaaatacgat
gaaatgtcggattgcctggcccggctcgaccacgacgatctgatgccggcggagcgtgat
gagattgtggcccgcctgtcacggctgattactgaggcctggcacaccgacgaaatccgc
catgagcggccgacggctgtggacgaggccaagtggggctttgcggtcattgagaacagc
ctctggcaggcattgcccagattccttcgaagcctggaccagtcactttctgatgcaacg
ggcaaaggcctgcccctgcagaattccccgattcgtattgcctcctggatgggaggggac
cgagacggtaacccgaacgtgactcacgatgtgactcgtcaggtcttcctgctgggccgc
tggatggctgccgatctttacctgcgggatattcaggctctgagggccgagttatccatg
tggcaggccagtgatgaactgagggcacgggtcggtgattgccgggagccctatcgtcag
gtactggccgagttgcgggagcgcctggtccgtacccgggactgggccgaggccggcgtt
aaaggcctcgtagcggacgagaccggtatcctgtttgagaacgaagacctgacggctccc
ctggagctgtgttatcgatcactgatggattgcggcctggagcaaattgccaacggcccg
ctgttggacaccattcgccgtgctcacacattcggactgccgctgattcgcctggatatc
cggcaggaggcttcccggcatgcggaggcggtggcagagatggtggattacctggggctg
ggagactatctgtcctggtcggaagacgaccggcaggcattcctgctgcgcgagctgcaa
ggccgccggccactggtgccccgcaactgggaaccttcagagtcagtcagggaagtgctg
gctacctgcgaggtggtggcgggccagaccccggaagcgctgggttcctacgttatctcc
atggccagcaagccttcagatgtattgaacgtgatcctgttgttgcgggaagcgggaatg
aagttcccgatgcgtgtggtgcctttgtttgaaaccctcagcgatcttcagggtgcacca
gacagcatggctgccctgtatcaggttgattggtaccgcgagtactgccagggccgccag
gaggtgatgattggctattcggactcgtccaaggacgccggccagctgatggcagcctgg
gcccagtaccaggcgcaggaaaaactcacccaggtggcccgccagtatggcgtgcacctg
accctgttccacggtcgcggcggcacggtgggccgtggtggcggcccggcgaaccgggcg
attctgtcgcaaccgccgggatcggtaaacggcagtttccggattaccgagcagggggaa
atgatccgattcaagttcggtttgccccggctggcggtacaaagccttaccctgtacacc
actgccgtcattgaggcgaccctggcgccaccgccacaacccgaggacagctggcgcgag
atgatggactggctgaccgagcgttccctcaaatcttaccgggaagtggtaagggagaac
ccggatttcgtgccttatttccggcaggttacacctgaaactgcgctgggtaagctggcc
ctgggcagtcgaccggcgcgccggaaagccaccggtggcgtggagagtttgcgagccatt
ccctggatttttgcctggacccaaatgcgcctgatgctgcccagttggctgggcagcgat
gtggccctggaggaagccgcccggcatcagcgcctgccagagctgcgtgagatgatgcgg
ggctggccgtttttccgcacctatgtcgacatgctggaaatggtgctggccaaagccgac
ctgcgcattgccagctattacgagcagaccctggtggaggatgaaagcctcagggccctt
gggggtagcctcagggaacggctgaacggctgtatcgagcgcgtgctggagctcaaggat
cagcaagccctgttggagagcgaaccggtgtttgcccattccatgagagtgcgcaacccc
tacacggacccattgcattaccttcaggcggaattgctcaaacgcgaccgcgagagtgag
ggcaaaggtgaggtgccggatatggtggagcgggcgctgaaagtcaccatggcgggcatc
gccgctggtatgcgtaatacgggctaa

DBGET integrated database retrieval system