KEGG   Marinobacter sp. LQ44: ASQ50_16830Help
Entry
ASQ50_16830       CDS       T04470                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
mlq  Marinobacter sp. LQ44
Pathway
mlq00250  Alanine, aspartate and glutamate metabolism
mlq00410  beta-Alanine metabolism
mlq00640  Propanoate metabolism
mlq00650  Butanoate metabolism
mlq01100  Metabolic pathways
mlq01120  Microbial metabolism in diverse environments
Module
mlq_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mlq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ASQ50_16830
   00650 Butanoate metabolism
    ASQ50_16830
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ASQ50_16830
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASQ50_16830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlq01007]
    ASQ50_16830
Enzymes [BR:mlq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ASQ50_16830
Amino acid related enzymes [BR:mlq01007]
 Aminotransferase (transaminase)
  Class III
   ASQ50_16830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AMQ90221
UniProt: A0A142FUR2
LinkDB All DBs
Position
complement(3672215..3673474)
Genome map
AA seq 419 aa AA seqDB search
MTDHKGKLSPLLKQATGITAAKGEGAYIIDPEGRRYLDFTSGIGVTSTGHCHPKVVAAAQ
KQVATMIHAQATTVMNPRLPELAEKLGELTPDPLNAFFFSNSGTEVAEGAVRLVRQATGR
PNVIVFHGGFHGRTMGSLSMTTSSVALRAGVSPMMGGVVVAPFPHAFHYGWSLDEATDFC
LRELDRIFVTYSAPKETAAMLIEPVQGEGGYVPANARFLKGLRERCDKHGIMLVFDEVQA
GFGRSGKFWAHEHFGVTPDAIMIAKGLASGFPISALAASEETMSKGWPGSQGGTYGGNAV
AAAAAIATIDVIREEGLVENADRMGKRLWDNLHALKKDYPEMADVRGKGLMVGVEMRRGD
CPDGERAGKILKECENRGLLMLRCGPYQEIVRWLPPLIVTQNQIDEATGIFEEALKATA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccataaaggcaaactgtcccccctgctcaagcaggctaccggcattacggcc
gccaaaggcgaaggcgcctatattattgaccccgagggccgtcggtatctggatttcacc
tccggcatcggtgtcaccagcaccggccactgccacccgaaagtggtggccgcagcccaa
aaacaggtggctaccatgattcacgcccaggccaccacggtaatgaaccccaggctgccg
gaactggcggaaaaactcggagagctgacaccagaccctctgaatgcctttttcttctcc
aactccggcaccgaggtggccgagggcgcggttcgcctggttcgccaggccaccggacgc
cccaacgtgattgtattccatggcggcttccacggccgcaccatggggtcattgtccatg
accacctccagcgttgccctgcgggccggtgtcagccccatgatgggtggcgttgtggtt
gccccctttccacacgcttttcactatggctggagcctggacgaagccaccgacttctgc
ctgcgggagctggacagaatcttcgtaacttattccgcccccaaggaaaccgccgccatg
ctgattgagccggttcagggtgaaggcggctacgtacccgccaacgcccgcttcctgaag
ggccttcgggaacgctgcgacaaacacggcatcatgctggtgttcgatgaagtgcaggcc
ggcttcggccgcagcgggaagttctgggcccatgaacactttggcgtaaccccggatgcc
atcatgatcgccaaaggcctggccagcggcttcccgatctctgccctggcggcttccgag
gaaaccatgtccaaaggctggcccggttcacagggtggcacctacggaggcaacgccgtg
gctgcggcggcagctattgctaccatcgacgtcattcgcgaagagggcctcgtggaaaac
gcagaccgcatgggtaaacgcctgtgggacaatttgcatgccctgaaaaaggattatccg
gagatggccgatgtccggggcaaaggcctgatggtcggagttgaaatgcgccggggcgac
tgccccgatggcgaacgggccggcaagatcctcaaggaatgcgaaaaccggggattactg
atgcttcgctgcgggccttaccaggaaatcgtccgatggctgccgccactgatcgtcacc
cagaaccagattgatgaagcgaccggcatcttcgaggaggccctgaaagccaccgcctga

DBGET integrated database retrieval system