KEGG   Melampsora larici-populina: MELLADRAFT_102419Help
Entry
MELLADRAFT_102419 CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00052  Galactose metabolism
mlr00500  Starch and sucrose metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MELLADRAFT_102419
   00500 Starch and sucrose metabolism
    MELLADRAFT_102419
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     MELLADRAFT_102419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 18921670
NCBI-ProteinID: XP_007405292
JGI: Mellp1_102419
UniProt: F4R886
LinkDB All DBs
Position
Unknown
AA seq 735 aa AA seqDB search
MDIKRLFLLLVFFISLSFLALAQCPTYRATNVTSANNSLHAILSLDGPACSTRDVTSLNL
IVTYEETTRLHVRILDASSNRYEVPEQVVPRPSSAFVQPSQAALAFSYDAFPFSFTVTRR
ANNETLFSTSDGPPLVYRDRHISLRTVLPLTAAIFGLGESTDPFRIPPGTLRTLWARDAY
GTDEHTNLYGSHPVYFDHRPSGTHGVFLLNSNGMDVSVESDFLQYDIIGGVLDLYFLSGP
SPIEVAQQYSQIIGRPAMVPYWSLGFQQCRFGYKSLLIFLILGWTDIDYMNHSRVFTLDP
ENFPLQRMREIVDQLHAHNQRYVMVMDPAVAYQPGDNGAFDRGTKSDIFLKEANGTYYKE
MVWAGASVYPDWFHTSIQSYWSGEFQRFFDPESGIDIDGILIDMNEPALPVANVRVVAKT
TLRTLSLKRKQRRQAENRSVDEYDTHNLFGTLMSSITRKAMLERRPNLMPVIISRSTFPG
LGARAGHWTGDNISDWTHYRASIIQMLSFASIFQIPFVGSDVCGFGGNATEELCGRNHNE
VGSLSQEFYRWSSVTRAARVAIILRYSLLDYLYTQLRWQQHDGTPAIQPLWFVYPDDPQL
INIQSQFFFGDALVSDIFSFVSFARNGHELKFNVAENDQTRQLVSPVMEENSTSVKAYIP
EAGISGLRITGREAHIKAEVKMVTFLATLGVQDARVTGGGQGELRVDSEAKIVQVIGNWS
LSMGDQLLFELELET
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggatatcaagcgcttgtttctccttctggtctttttcatcagtctttcatttctagct
ttggctcaatgcccaacttatcgagccacaaacgtaacatcagcgaataacagtctacat
gccatactcagcttagatggcccagcatgcagtacgagagacgtcacctcactgaacttg
atcgttacctatgaagaaactactcgtcttcacgtgagaatcttagatgcctcatcgaat
agatacgaggtcccagagcaggtcgtgccccgcccatcttccgcatttgttcagccctcc
caggccgccttggcattctcttacgacgccttcccgttctccttcaccgtcactcgccgg
gccaacaatgagacacttttttcgacatcagatggtccacccctcgtgtatcgagaccgt
cacatcagcttgcgaactgttcttccactcacagccgcgatttttggcttaggagaaagc
acggatccttttcgaattcctccgggaactttgcgtaccctatgggcgcgtgatgcatat
ggtacagatgagcacaccaacttgtatggctctcatcccgtatactttgatcatcgtccc
tcaggaacacacggtgtcttcctcttgaactcgaatggaatggacgtatcagtagaatca
gacttccttcagtatgatatcattggaggtgttctggatctttacttcttgtccggcccc
tccccgatagaggttgcacagcagtattctcagatcattggtagaccagccatggttccg
tactggtcacttggatttcagcagtgccgatttggctacaagagtttgctcatattttta
atccttgggtggacagatatcgactacatgaatcacagcagagtcttcacacttgaccca
gaaaatttccctctccaacgcatgagggagatcgttgatcagcttcatgcgcacaatcag
cgctatgttatggtcatggacccagccgttgcctatcagccaggagacaacggtgctttc
gatcgtggcacaaaatcggatatatttctcaaggaagccaatggtacctactataaagaa
atggtatgggcaggcgcgagtgtatacccggattggtttcacacatcaatacagtcatat
tggtcaggagaattccaaagattctttgacccagaaagtgggatcgatatcgatggtatt
ttgatcgacatgaacgagcctgctttaccagttgcaaacgttcgcgtcgttgccaaaaca
actttgcgcacgctctctttgaaaaggaaacagcgacgtcaggctgagaatcgtagtgtg
gatgaatacgatacccacaacctcttcggaacacttatgtcatcaatcactcgcaaggca
atgttagagcgaagaccaaatctaatgcccgtgatcatcagtcgctcaacttttccaggc
ttgggtgctcgtgcgggtcattggactggagataacatttcagattggacgcactatagg
gcctcgataatacagatgctctcattcgcctccatctttcagattccctttgtaggctca
gatgtttgcggttttggtgggaacgcaacagaagagctatgtggtcgaaaccacaacgaa
gtgggttcattgagccaagagttttatcgctggtcaagtgttacccgagcggccagggta
gctatcatcttgaggtatagccttctagactacttatacactcagctacgatggcaacag
cacgatggaacccctgcgatccagcctctttggtttgtctaccccgatgatccgcagctt
atcaatatacaaagtcagtttttcttcggagacgcccttgtaagtgacatcttcagcttt
gtatcattcgcgaggaatggtcatgagttgaaattcaatgtggctgaaaatgatcaaaca
cgacagcttgtttctccggtcatggaggagaattcaacttcagtgaaggcatatattcct
gaagcaggcatttccggcttgagaattactgggcgagaagctcatatcaaagcagaagtg
aagatggtaacatttttagcgactttgggtgtacaagacgcacgggtaactggaggggga
caaggggagttgagggtggactcagaagcaaagatcgttcaagtgattggaaattggtca
cttagtatgggagaccagctattatttgagctcgagctcgagacttga

DBGET integrated database retrieval system