KEGG   Melampsora larici-populina: MELLADRAFT_115101Help
Entry
MELLADRAFT_115101 CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00020  Citrate cycle (TCA cycle)
mlr00310  Lysine degradation
mlr00380  Tryptophan metabolism
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
mlr01130  Biosynthesis of antibiotics
mlr01200  Carbon metabolism
Module
mlr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MELLADRAFT_115101
  Amino acid metabolism
   00310 Lysine degradation
    MELLADRAFT_115101
   00380 Tryptophan metabolism
    MELLADRAFT_115101
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     MELLADRAFT_115101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 18925524
NCBI-ProteinID: XP_007404678
JGI: Mellp1_115101
UniProt: F4R592
LinkDB All DBs
Position
Unknown
AA seq 1033 aa AA seqDB search
MHRINSIPISSVHRITSKPSTSSLRSTTTQLHHYQTYHHQQRSLATAASQDVLRKSPSPV
DAFINSNNSYYIEEMYRTWKKEPDSVHPSWRAYFNGIKNGLPSEKAFIPPPGLVSMPNPA
GGAPMLSLSGQGGELEDHMKIQLLVRAYQVRGHHMASLDPLGIHAADLESRPPPELDLKH
YGFDEHTDSNKEFRLGPGILPLFHTEGREKMTLKEIVDACKRIYCSHIGLQYVHLPDRTE
CDWIRERVELPVPWSYSLEEKRMILDRLIWSDSFERFVASKHPNEKRFGLEGGESLIPGM
KALIDRSVDAGVKSIVIGMPHRGRLNVLSNVVRKPMEAIFNEFAGSADASEDGGGDVKYH
LGANYVRPTPSGKKVALSLVANPSHLEAEDPVVLGKTKALQHFDGQGSTDHAMGILLHGD
AAFAGQGVVYETMGFHDLPNFGTGGTVHLVINNQIGFTTDPRQGRSTPYPSDIAKSIDAP
IFHVNGDDAEAVTFVCQLAADWRATFKKDVVVDIVCYRRHGHNETDQPSFTQPKMYQAIA
NQPSTLKIYSENLVKEGSFTEQEIEKHKEWVWGMMEKAYQGSKDYTPTSREWLSSSWDGF
PSPKELKENILEARPTGVSTERLLKIGEKISGGWPSKFEVHKNLSRILKNRGKTISEGKE
IDWSTAEALAFGSLLMEGNHVRVSGQDVERGTFSQRHAVLHDQQTNETYIPLSNLEQDGE
NQVGPFTICNSSLSEFGALGFELGYSLVDPHLLTIWEAQFGDFANNAQCIIDQFICSGER
KWFQRTGLVMSLPHGYDGQGPEHSSARIERFLQLCDDHPYKVPTPEKSQRAHQDCNMQLV
YCTTPSNYFHVLRRQIHRDFRKPLIVFFSKALLRHPMAKSNLNEMEIGTFFQPFLLEEGY
DGMVEKDLIKRHIFCSGQVYYTLVQEREKRKINNIAISRIEQLSPVPYTEILNSFSTFPN
AEIMYCQEEPINGGAFSYLAPRLETAMEQTETHRGQKVLYAGRPPYASVATGSKKIHQHE
INQFLDQALKLDE
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atgcataggattaattcaatcccaatctcatcagtacatagaatcacctcaaaaccttct
acaagttctcttagaagtactactactcaacttcatcattatcaaacttatcatcatcaa
caaagatcattagctactgctgcttctcaagatgtcttacgaaaatcaccttcaccagtt
gatgcattcattaactcaaacaatagttattatatagaagaaatgtatcgtacttggaaa
aaagaaccagattcagttcatccatcttggcgtgcatatttcaatggaatcaagaacggt
ttaccatccgaaaaagcttttatacctccacctggtttagtttctatgccaaatcctgct
ggtggtgctccaatgttatcactttcaggtcaaggtggtgaattagaagatcatatgaaa
attcaattattggtcagagcttatcaagttagaggtcatcatatggcttcattagatccc
ttgggaattcatgctgccgatctcgaatctcgtcctccacccgaattagatttaaaacat
tatggatttgatgaacacactgattcgaataaagagtttcgattaggtcctggtatctta
cctttatttcatactgaaggtcgcgagaagatgacattgaaagagattgtagatgcttgt
aaacgaatctattgtagtcatattggattacaatatgtacatttacctgatcgaacagaa
tgtgattggataagagaacgagtcgaattaccagtgccatggagttattcattagaagaa
aaacgaatgatattagatcgattgatctggtccgattccttcgaacgattcgtcgcatct
aaacatcctaatgaaaaacgttttggtcttgaaggtggtgaaagtttgattcccggtatg
aaagctttaatcgatcgatcagtggatgcaggcgtgaagagtattgtgattggaatgcca
catcgtggtagattaaacgttttgtctaacgtggttcggaaacctatggaagctatcttc
aatgaatttgctggttcggctgatgcttcggaagatggtggtggtgatgtgaagtatcat
ttaggtgcaaattatgttagaccgactccttcgggtaaaaaagtcgctctttctcttgtt
gcgaatccttctcatcttgaagcagaagatccagtcgtacttggtaaaaccaaagcatta
caacatttcgatggtcaaggttcaaccgatcatgctatgggtattcttctacatggtgat
gcggctttcgctggacaaggggtggtttatgaaaccatgggatttcacgatcttcccaac
tttggaaccggtggaacagttcatttagtgatcaacaatcagatcggtttcactactgac
cctcgtcaaggtcgttcgactccatacccttctgatatcgctaaatccatcgatgctcca
atcttccatgttaatggtgacgatgccgaagcggtcacatttgtctgtcaactggcagca
gactggagagctacgttcaagaaggatgtcgtagtggatatcgtctgttaccgtcgtcat
ggtcataacgaaaccgatcaacctagctttacgcaacctaagatgtatcaagccatagcc
aatcaaccctctacgctgaaaatctattcagaaaatcttgttaaagaaggttcctttacc
gaacaagaaatcgagaaacataaagaatgggtatggggtatgatggaaaaagcttaccaa
ggtagtaaagattatacaccaacttcaagagaatggttatcaagttcatgggatggattc
ccatcacccaaagaactgaaagaaaacattttagaagccagacctacaggtgtatcaacc
gaaagattattaaagattggagaaaagatctcaggtggatggccatctaaatttgaagta
cataagaatttatcccgaatcttaaagaatcgaggtaaaacgatttcagaaggaaaagag
attgattggtcaacggccgaagcacttgcattcggatcacttttgatggaaggaaatcat
gtgagagtatcaggtcaagatgtagaaagaggaaccttttctcaacgtcatgcagtttta
catgatcaacaaaccaatgaaacttatattcctttaagtaatttagaacaggatggtgaa
aatcaagtagggccatttacgatttgtaattcatctttatctgaatttggagccttagga
ttcgaacttgggtattcgttagttgatccacatttattaacgatttgggaagcccaattt
ggtgattttgcaaataatgctcaatgtatcattgatcaattcatttgttcaggtgaacga
aaatggtttcaacgtactggtttggtcatgtcacttccacatggatatgatggacaagga
ccagaacattcgagtgcaaggattgaaaggtttttacaactttgtgatgatcatccctat
aaagtacccacaccagaaaaatcacaaagagcacaccaagattgtaatatgcaattagtt
tattgtacaacaccatcaaattattttcatgtgttaagacgacagatccatcgagatttt
agaaaaccattgatcgtgttcttttcaaaagctttattgagacatccaatggctaaatcg
aatttgaatgaaatggaaatcggaacattctttcaacctttcttgttggaagaaggatat
gatggaatggttgaaaaagatttgattaaacgacatatcttttgctctggacaagtttat
tatactttagttcaagaacgtgaaaagagaaagattaataatattgcgatttcaagaatc
gaacaactttcacctgtaccttatactgagatcttaaactccttctcgacttttccaaat
gctgagattatgtattgtcaagaagaacctatcaatggtggagcgttttcatatcttgca
cctagattagaaactgctatggaacaaactgaaactcatcgaggtcaaaaggttttgtat
gctggtagaccaccttatgcatctgttgcgactggtagtaagaagattcatcaacatgaa
attaatcaattcttggatcaagctttgaagttggatgaatag

DBGET integrated database retrieval system