KEGG   Melampsora larici-populina: MELLADRAFT_30357Help
Entry
MELLADRAFT_30357  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K18045  tyrosine-protein phosphatase SIW14 [EC:3.1.3.48]
Organism
mlr  Melampsora larici-populina
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mlr01009]
    MELLADRAFT_30357
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     MELLADRAFT_30357
Protein phosphatases and associated proteins [BR:mlr01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    MELLADRAFT_30357
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase2 Y_phosphatase3 DSPc Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 18927101
NCBI-ProteinID: XP_007406868
JGI: Mellp1_30357
UniProt: F4RD04
LinkDB All DBs
Position
Unknown
AA seq 136 aa AA seqDB search
MAPLVPPLGFAMVSPGIYRSGHPNYRNFAFLEGLKLTSIMYLCADNYRPHTFNWAQDRGL
KIFHYRIDLSKDPNSPITPHSIYSEALTDILDTRNHPILIHCNKGKNRVGTICAILRRYQ
AWNLDSIQDEWNKFFG
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggctcctttggtgcctcctttaggttttgctatggtgagtcctgggatttatcgttct
ggacatcctaattataggaattttgcttttttggaggggttgaaacttacttcgatcatg
tatctttgtgctgataattatagaccacatacgtttaattgggcacaagatcgtggattg
aaaatctttcattacagaattgatttatcaaaagatcccaattcaccaatcacaccccac
tcgatctacagcgaagcattaaccgacatcttagacacccgaaaccatccgatcttaatc
cattgtaacaaaggcaaaaaccgagtaggaacaatctgtgccatcttacgtaggtatcaa
gcatggaacttagattctattcaagatgaatggaataagtttttcggt

DBGET integrated database retrieval system