Melampsora larici-populina: MELLADRAFT_34638 Help Entry MELLADRAFT_34638  CDS       T03138                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism mlr  Melampsora larici-populina Pathway mlr03060   Protein export mlr04141   Protein processing in endoplasmic reticulum mlr04145   Phagosome Brite KEGG Orthology (KO) [BR:mlr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     MELLADRAFT_34638    04141 Protein processing in endoplasmic reticulum     MELLADRAFT_34638  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     MELLADRAFT_34638  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mlr04131]     MELLADRAFT_34638   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mlr02044]     MELLADRAFT_34638 Membrane trafficking [BR:mlr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     MELLADRAFT_34638 Secretion system [BR:mlr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    MELLADRAFT_34638 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-GeneID:  18927403 NCBI-ProteinID:  XP_007407444 JGI:  Mellp1_34638 UniProt:  F4REG1 LinkDB All DBs Position Unknown AA seq 60 aa AA seqDB search TSTRAAGHGGSSNTMMRLYTQDDNIGLKAEPVVVLGLSVAFVASVVCLHLAGKYMRWFMK NT seq 183 nt NT seq  +upstreamnt  +downstreamnt acttctactagagctgctggacatggtggaagtagtaatacgatgatgagactttatact caagatgataacattggtttgaaagctgaaccggtggtggttttgggtctttcagttgct tttgttgcttcggttgtttgtcttcatttagctggtaaatacatgagatggtttatgaaa taa

DBGET integrated database retrieval system