KEGG   Melampsora larici-populina: MELLADRAFT_35944Help
Entry
MELLADRAFT_35944  CDS       T03138                                 

Definition
(RefSeq) family 15 glycoside hydrolase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00500  Starch and sucrose metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MELLADRAFT_35944
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MELLADRAFT_35944
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-GeneID: 18927518
NCBI-ProteinID: XP_007409938
JGI: Mellp1_35944
UniProt: F4RKU1
LinkDB All DBs
Position
Unknown
AA seq 550 aa AA seqDB search
MTIINSSAFLKRLPSRSGNPSHQQVVALVASTAALSVAGLWLSRHFSNFSPSKAFPFVSR
GQQNSKEKEPKLGLDGWIHYQKLFALTSIVAAFGPDGKNATGTSTGCMIASPSRPGSYLD
PENENENYFFQWTRDGSLCLRTILRKLEEVEMGELIGLENEDFNRLDDLIKGFIIMNRKL
QFLDNPSGSPWNGGLGEPKFLVNGTPFEATWGRPQNDGPAIRASTLIRYAKHLVETHTDQ
QAQIEGLKFIESTLYSKGDPNSFISMDINHVCETWRLPTFDLWEEVKATNGGHFYTLMVQ
RRAVQDMLDFVSSRPYFQPADETILHKYRNTLVEMDTRLEEFWNPEGVGKREGGPGWNSK
IIEDCLRLISDQVLNKPHILPTLDRLDDVFSAVYKINSQQSKLDGIAIGRYPEDNYDGKG
SSVGHPWFLCTNTVAETLYLTAHHFKKTGSITITPISLTFFQRFISDLEIPENTPLVISR
GSEMFTKLVKGIKQWADTFLEDVRGYGSLGSKMSEQIHRETGMMRGARELTWSYASFLTA
IDARDGKAPN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcataaactcatcagcattcttgaagcgacttccatctcgaagtggtaatccg
tctcatcaacaggtcgttgcacttgtcgcctccactgccgctttaagcgttgctggtcta
tggttatcgcgtcatttttcgaatttctcaccatcaaaagcttttcctttcgttagtcgt
ggtcaacaaaactcaaaggaaaaggagccaaagttaggattagacggatggattcattat
caaaaactatttgcgcttactagcatcgtggctgcttttggacctgatggtaagaatgca
acaggtacttctactggatgtatgatcgcatcaccatctagaccaggttcttatttagat
ccagaaaacgagaatgaaaattatttttttcaatggactcgtgatggaagtttatgttta
agaacgattttaagaaaattagaagaagttgaaatgggtgaattgatcggattagaaaat
gaagatttcaatcgtcttgatgatttgattaaaggatttattatcatgaatcggaaatta
caattcttagataatccttcggggtctccttggaatggtggattaggtgaacctaaattt
ctggtcaatggaactccatttgaagcaacttggggtcgacctcaaaatgacggccctgct
attcgcgcttcaactttgattcgatatgcaaagcatctcgtcgaaactcatactgatcag
caagcccagatcgaagggttgaagttcatcgagtccaccttgtattcgaaaggcgatccc
aactcttttattagcatggacattaatcatgtctgtgaaacctggcgcctcccaacgttt
gatttatgggaagaagtcaaagctaccaacggaggtcacttttatactttgatggttcag
cgaagagcggttcaagacatgctcgattttgtttcttcgcgaccttattttcaaccagct
gacgaaactatactccacaaataccgcaacacgctggtcgagatggatacaagacttgaa
gagttttggaatcccgaaggagtaggtaaacgtgaaggagggccaggttggaatagtaag
atcattgaggattgtctacgattgataagtgatcaagtactcaacaagccacatatactt
cctactttggatagactagatgatgtcttttcagccgtgtataaaatcaatagtcaacaa
agcaaattggacggaatcgctattggaagatatccggaggacaattacgatggcaaggga
agctcagtcggtcatccttggttcctctgcacaaacactgttgccgagacactttaccta
acagcccatcacttcaaaaaaaccggttcaatcaccatcacacctatcagtttaacattt
ttccaaagattcataagtgatttagaaatacctgaaaatacaccattagtgatttctcgt
ggttctgagatgtttacgaaattggtcaaaggaattaagcaatgggctgatacgttttta
gaagatgttagagggtatggatcattgggatctaagatgagtgaacaaattcatcgagag
actggaatgatgagaggtgctagagagcttacttggagttacgcttcattcctgactgcg
attgatgctagagacggtaaagccccaaattag

DBGET integrated database retrieval system