KEGG   Melampsora larici-populina: MELLADRAFT_36213Help
Entry
MELLADRAFT_36213  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MELLADRAFT_36213
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MELLADRAFT_36213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin
Motif
Other DBs
NCBI-GeneID: 18927538
NCBI-ProteinID: XP_007410561
JGI: Mellp1_36213
UniProt: F4RMT7
LinkDB All DBs
Position
Unknown
AA seq 1386 aa AA seqDB search
LLILFFLLAFISSWTYKLKVLNKYSFLPKPSKLNQTNQIQLDHLNPNLLVNQNQSFSAHD
EFHNYLDEFLSAIRVFGFLEKPVFHELARHLQTRRLLAGDTLSLDEDKSFYIVIDGHVEV
FARSNNHASTLPHHPSSLPNQSHQQRHSTYDHSLAYDHEDHNGFQLLNVVESGGTLSSLF
TILSLFTEDVKLRYEDDDEDEHQLKPSPMIRTTSLQAHPHQPHPSSDSIGSFNSQLSPTF
HSDPSPRSKPNRSVTLTSPIIRQPTAQSSAASRQPKHRSTAERLGAQPRESTIARATTDT
TLAVIPSEAFKRLTSKFPNAVAHILQVILTRLQRVTFLTSHQYLGLTKELLRTEKAFNEL
ACYPLPARFYEEGGMVRLRQRFLPQTKLVDEPSQSTRHQDYFGFDPINTRPSLNLRKAKD
LNDAALRLKPPHSPLRDPTPKSPKESHKSHITFDLGSSPISVPIGSTNNLHEDLELRQTV
MSCIAKSIGLVQHHRHQSETSSSSHHHPHQQQQVPQRPGFRSGLGSLSYLKTMGGGREDS
RSSIASSSVNIDSESPADDPDGEELPNEVEILFFHQDSTLVKAGERNAGLYFVIDGFLDV
FMPVDEEEDLSTGKSNEGRRRPISTLNPKEFKPEPEPMNELPSKPAPIKLFSIKPGGIAG
YLASISGFPSYVDIKAKTDVYVGFLPARALESIMDRKPIVLLTLAKRLISLLSPLMLHID
SALEWMAVDAGQIIYREGDKSDNLYIVIGGRLRSISERIEGGLEILGEYGQGESIGELDC
ITHTLRRSTLHAIRDSELVRIPMTLFNAISIRHPAITIQVSRLIASRVRKEIDASRSNSL
KRVQNNFNLKTVAIIPNRSEVDIIEFSNRLNFALESINAKTELLNQSTILSVLGRHAFSR
LGKLKLTGYLAELEQTFRIVLYVADTAVNAPWTQTCIKQADYVLLVCDGGSQPELGEYER
LLIGMKTTARKELVLLHPDRNVPAGSTRPWLKNRPWIHAHHHVQLAGATPLADNHLDEML
PVTALREFKERVRLQISKYARLRSKLKAEPVNVTGTDDFARLARRLCGKSIGVVLGGGGA
RGISHIGVIRALSEIGMPIDMIGGTSIGSFIGGLYARNSDLISTLGRAKVFSGRMATLWR
ILTDITYPVVAYTTGHEFNRGIYKSFYDYHIEDFWLPFWANTTNITWSRMEVHTTGYAWR
YIRASMSLAGLLPPLCDDGDMLVDGGYIDNLPVSVMLRMGADSIFAVDVGSIDDTSPRNF
PESLSGWWLLISRMNPWSENHRIPTMTDIQSRLTYVSSVKTLEEAKATPGVLYMRMPVTE
YTTMDFGKFEVICQKGYEAAKEMLKEWKEMGALPDGLERKSNEMNRLDGQLRENERKRLM
VRRNSV
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
ctattaatcttattctttctcttagccttcatctcttcatggacatacaaactaaaagta
ctcaacaaatattcattcttacccaaaccttcaaaactaaatcaaacaaatcaaatccaa
ctagatcatctcaatccaaacttgctcgtaaaccaaaaccaatctttttcggctcatgat
gaatttcataattatttagatgaattcttatcggctattagagtgtttgggtttctagaa
aaacctgtgtttcatgaactggctcggcatcttcaaacccgtagattattggcgggtgat
acgttgagtttggatgaagataaatcgttttatattgtgattgatggtcatgtggaagtc
tttgctagatctaataatcatgcttctactttaccccatcatccttcttcattaccaaat
caatctcatcaacagcgacattcgacctatgatcattctttggcttatgatcatgaagat
cataatggatttcaactcttgaatgtggtcgaatcgggtggtactcttagttctttattc
accatcttgagtttgtttactgaagatgttaaattaaggtatgaagatgatgatgaagat
gaacatcaacttaaaccgagtccaatgattcgaactacttcacttcaagctcatcctcat
cagcctcatccttcatcggattcgatcggttctttcaactctcaactttcgcctactttt
cattcggatccaagtccgagatctaaacctaatcgatcagtcactcttacttcacctatc
atcagacaacctactgctcaatcttccgcagcttcacgtcaacccaaacatcgatccacc
gctgaacgtctaggagctcaaccacgtgaatcgacgattgcacgtgccacgactgatacc
actttggccgtcatcccttcagaagcattcaaacgacttacatccaagtttccaaatgca
gtagcacatatcttacaagtcatcctcacacgacttcaacgggtcacttttctaacctct
catcaatacctgggtctaactaaagagcttttgagaactgaaaaagcttttaacgaatta
gcatgttatccacttccagctcggttttatgaagaaggtggaatggtaaggcttcgtcaa
aggtttttacctcagactaaattagtggatgaacctagtcaatcgacaagacatcaagat
tattttggattcgatcctatcaatactcgtccttctttaaatctacgtaaagctaaggat
ttgaatgatgctgctcttagattgaaaccccctcattcacctttacgtgatccgacgccc
aagtctccaaaagaatctcataaatctcatattacgtttgatttgggatcttcacctatt
tcagttccgatcggttctactaataatttacatgaagatctcgaattgaggcaaacggtg
atgagttgtattgcgaaatctattggactagtacaacatcatcgtcatcagagcgaaact
tcttcttcttctcatcatcatccacatcaacaacaacaagtacctcaacgacctggtttc
agatcaggactcggttcgttatcgtatcttaaaaccatgggcggtggacgagaagatagt
aggagttctattgcctcttcttcggtgaatatcgattcagaatcacctgctgatgatcct
gatggtgaagaattacctaatgaagtggaaatcttatttttccatcaagactctacactt
gtgaaagcaggtgaaaggaatgcaggactgtattttgtgattgatgggttcttggatgtg
tttatgccggtggatgaagaagaagatttatctactggtaaatcgaatgaaggaagaaga
agaccgatctcgactttgaatccgaaagagtttaagccagaaccagaaccgatgaacgag
ttaccaagcaaacctgcaccaatcaaactctttagtattaaaccgggagggattgcaggt
tatttggcttcgatctcggggttcccttcgtatgttgatattaaagctaagactgatgtg
tatgttgggttcttgcctgcgagagctttggaaagtattatggatcggaaaccgattgtt
ttgttgacgttggctaagaggttgattagtcttttgtctccacttatgttacatattgat
tcagctttagaatggatggcagttgatgcaggacaaattatttatcgtgaaggagataag
agtgataatctatatattgtgattggaggtagattacgatcgatctctgaaagaatagaa
ggaggacttgagatcttaggggaatatggacaaggcgaaagtataggagaattagattgt
attacgcataccttaagaagatctaccttacatgcgatacgtgatagtgagctggttagg
attccaatgaccctctttaatgcgatttcgattcgacatccggctattactattcaggtt
tctaggttgattgcttcaagggttcggaaagagattgatgcatctagatcgaattctttg
aaaagagttcaaaacaactttaatttgaaaacggtggcgattattcctaatcgatcggaa
gtcgatattattgagttttcgaatcgtttgaactttgctctcgaatcgattaatgctaaa
actgaacttttgaatcagtcgacaatcttgtctgtcttgggtcgtcatgcttttagtaga
ttgggtaagttgaagttgaccggttacttggcggaactcgaacagacttttaggatcgtg
ctttatgtggctgatacggcggttaatgcgccttggactcagacttgtattaaacaggca
gattatgttttgttggtttgtgatggtggatctcaacctgagttgggagaatatgaacgt
ttgttgatcgggatgaaaacgacggctcgtaaagaattagtcttactacatcctgatcga
aacgtacctgcaggttcaaccagaccttggttaaagaatcgaccttggattcatgcgcat
catcatgttcaacttgcaggagccacaccattagcagataatcatttagatgagatgtta
ccggtcacagcactaagagagtttaaagaaagagtccgattacaaatctcaaagtatgca
agacttcgatcgaaattaaaagccgaaccagtgaatgtgacaggcactgatgattttgca
agactagctagaaggttatgtggcaaatcgattggagtggtcttgggaggaggaggagcc
agagggattagtcatattggagtcattagagctttgagtgagattggaatgccgatcgat
atgattggtggaacgtcgattggaagctttattggtggactttatgctaggaattcggat
ttgatttcgacattgggtagagcaaaggtctttagtggtcggatggctactttgtggaga
atcttgacggatatcacttaccctgtggtggcttatactacgggtcatgagtttaataga
gggatttataaatcgttttatgattatcatattgaggatttttggttaccattttgggct
aatactactaatataacttggtcaagaatggaagtccatacaactggatatgcttggagg
tatattagggcttctatgtctttggctgggttgttaccaccgctttgtgatgatggagat
atgttggtagatggagggtacattgacaatttaccggtttcagtgatgttgaggatggga
gccgattcgatctttgcagttgatgtaggatcgattgatgatacttcacctagaaacttt
cctgaatcactttcaggttggtggttattgattagtcgaatgaatccttggtcagaaaac
catcgaataccaactatgacagatattcaaagtcgattgacttatgtttcgagtgtgaag
actttagaagaagctaaggcgacaccaggagtactttatatgaggatgccagtaactgaa
tatactactatggattttggaaagtttgaagtgatttgtcaaaaaggatatgaagcggca
aaggagatgttaaaggaatggaaagagatgggagctttacctgatggattagaaaggaaa
tctaatgagatgaatcgattggatggacagcttagagagaatgaaaggaaaaggttgatg
gttagaaggaatagtgtttga

DBGET integrated database retrieval system