KEGG   Melampsora larici-populina: MELLADRAFT_36766Help
Entry
MELLADRAFT_36766  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
Organism
mlr  Melampsora larici-populina
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Init_tRNA_PT Y_phosphatase
Motif
Other DBs
NCBI-GeneID: 18927579
NCBI-ProteinID: XP_007411342
JGI: Mellp1_36766
UniProt: F4RQF0
LinkDB All DBs
Position
Unknown
AA seq 54 aa AA seqDB search
DDALLHSSAVYVHCKAGKSRSVTIVLAYLIHRYKISLKESYEFVSNRRKGICPS
NT seq 165 nt NT seq  +upstreamnt  +downstreamnt
gatgatgcattattacattcatcagccgtttatgtacattgtaaagcaggtaaatctaga
tcggtgaccatcgtcttggcttatttgattcatcggtataagatctcattaaaagaatcg
tatgagtttgtttcgaatcgaagaaaaggaatttgtccaagttga

DBGET integrated database retrieval system