KEGG   Melampsora larici-populina: MELLADRAFT_44058Help
Entry
MELLADRAFT_44058  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00020  Citrate cycle (TCA cycle)
mlr00190  Oxidative phosphorylation
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
mlr01130  Biosynthesis of antibiotics
mlr01200  Carbon metabolism
Module
mlr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mlr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mlr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MELLADRAFT_44058
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MELLADRAFT_44058
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MELLADRAFT_44058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 Lycopene_cycl HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 18928152
NCBI-ProteinID: XP_007411829
JGI: Mellp1_44058
UniProt: F4RRT7
LinkDB All DBs
Position
Unknown
AA seq 648 aa AA seqDB search
MLRSISSSIKPPLSKLIKSQRGFSTTQSCSKIISTQPLKASQAPSIISSGKYPIIDHEYD
AIVVGAGGAGLRAAFGLAEAGLNTACITKLFPTRSHTVAAQGGVNAALGNMTEDDWRWHM
YDTVKGSDWLGDQDAIHYMCKEAPQAVIELEHFGVPFSRTKDGKIYQRAFGGQSLKYGKG
GQAYRCAAAADRTGHAILHTLYGQSLRHNTNFFVEFFALDLIMDDAGRCVGVTAYNQEDG
TLHRFRAHQTVLATGGYGRAYFSCTSAHTCSGDGNAMVTRAGLPLQDLEFVQFHPTGIYG
AGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPDKD
HCYLQLSHLPPEVLHERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGQVI
TQDSKTGADKIVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRACAKHIAANLEPNQP
HAKIAEDAGMKSIDDLDRLRNASGPKPTAEIRSDMQKVMQSDAAVFRTQSSLEEGVTKIN
KVVDSFKDIGVTDRSMIWNTDLVETLELRNLLTCAAQTMASAEARKESRGAHAREDFPER
EDDTWMKHTLSWHEPEAGKPVKLTYRDVISNTLDENECKSVPPFKRTY
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgttcaatctcatcttcaatcaaaccacctctctcaaaacttatcaaatctcaa
cgtggcttttcaactactcaatcatgttctaaaatcatctcaacccaaccactcaaagct
tctcaagcaccatccatcatctcatccggaaaatatcctatcatcgatcatgagtatgat
gcaattgtcgtaggagctggtggggctggtttgagagccgcctttggacttgctgaggct
ggtttgaacacggcttgtatcaccaaattattccctactcgaagtcatacagtcgctgct
caaggtggtgtcaatgctgcgttaggtaacatgactgaggatgattggcgatggcacatg
tacgacactgtaaagggttccgattggctgggagaccaagatgcaatccattacatgtgc
aaggaagcacctcaagcagtcatcgagctcgagcactttggtgtgcccttctctcgtacc
aaggatggcaagatctaccaacgtgcttttggaggtcaatccttgaaatacggaaagggt
ggacaagcatacaggtgcgcggctgccgcggaccgaaccggacatgccatccttcacaca
ctttatggtcaatcattacgacacaatacaaatttcttcgtcgaattctttgcactcgac
ttgatcatggatgatgccggtcgatgtgtgggagtgacagcttacaaccaagaagatgga
acgttacatcggttcagagctcatcaaaccgttcttgctactggtggttacggacgtgct
tacttctcatgtaccagtgctcacacttgttctggtgatggtaatgctatggtcacaaga
gccggtttacccttacaagatttggaattcgttcagttccaccctactggaatctacggt
gctggttgcttgattactgaaggttctagaggagaaggaggttacctacttaactctgaa
ggcgaacgatttatggaacgatacgcacctaccgctaaagatctggcttctcgagatgtc
gtatcacgatccatgacgattgagatccgcgaaggtagaggagttggaccagacaaagat
cactgctatcttcaactatctcatttacctccagaagttcttcacgagcgattaccagga
atttctgagactgctgctatctttgctggcgttgatgtcacaaaagaacctatccctgtc
ttgccaactgtgcattacaacatgggaggtattcctaccaactatcacggtcaagtgatc
actcaagactccaagaccggggcagacaagattgtgcctgggctctacgcagcaggtgaa
gcagcttgcgtatccgtccacggtgctaaccgtctcggcgcaaactctctactcgacatc
gtcgtgttcggtcgagcatgcgccaaacacattgctgctaaccttgaaccgaaccaacct
cacgccaagattgctgaggatgctggtatgaaatcgattgatgatcttgatcgactcaga
aatgccagtggacctaaacctaccgccgagatccgaagcgatatgcaaaaggtgatgcaa
agtgatgcggctgtcttcaggactcaatccagcttggaagagggagtcacaaagatcaac
aaagtggtagactctttcaaagatattggagtgactgatcgaagtatgatctggaacact
gatttggttgagacactcgaactccgaaacttattgacttgcgctgctcagaccatggca
tctgctgaagctcgaaaagaatcacgtggagctcatgctcgagaagatttccctgaaaga
gaagatgacacctggatgaagcacactttatcatggcacgaacctgaagctggcaagcct
gtgaaattaacctatcgggatgtgattagcaacacattagatgagaatgagtgtaagagt
gttccacctttcaagcgaacatattga

DBGET integrated database retrieval system