KEGG   Melampsora larici-populina: MELLADRAFT_46171Help
Entry
MELLADRAFT_46171  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00010  Glycolysis / Gluconeogenesis
mlr00051  Fructose and mannose metabolism
mlr00052  Galactose metabolism
mlr00500  Starch and sucrose metabolism
mlr00520  Amino sugar and nucleotide sugar metabolism
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
mlr01130  Biosynthesis of antibiotics
mlr01200  Carbon metabolism
Module
mlr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mlr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MELLADRAFT_46171
   00051 Fructose and mannose metabolism
    MELLADRAFT_46171
   00052 Galactose metabolism
    MELLADRAFT_46171
   00500 Starch and sucrose metabolism
    MELLADRAFT_46171
   00520 Amino sugar and nucleotide sugar metabolism
    MELLADRAFT_46171
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MELLADRAFT_46171
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mlr04131]
    MELLADRAFT_46171
Enzymes [BR:mlr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     MELLADRAFT_46171
Membrane trafficking [BR:mlr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    MELLADRAFT_46171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 18928312
NCBI-ProteinID: XP_007418887
JGI: Mellp1_46171
UniProt: F4RQP7
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MTTSNSSTANHSNSNHSKSQTAAHQHHHHHPHGFDPNTRKSVTIRRRSGSRSLADGRGSI
VVHTRTHENAELPHATKMQMADYLRKFEHLFTVTPQRMRMIVDAFIDTLEIGLKENGQAV
PMIPTYVFGWPSGKETGPYLAVDLGGTNLRVCHVELEGEGKFEITQAKYKLTEEQKQQEG
EKLFDFCAECLHTFIYDQYADEAGNLQLEEEIALGFTFSYPCIQKRIDHGELLRWTKGFG
NPNVEGHDVGEMFAKALKKHNVPIKLTALINDTTGTLIASSYVDPSTRIGVIFGTGCNAA
YMEKISNIPKIAHLGLPPDAEMAINCEWGAFDSEKHEHLPRTKYDLIIDETSNKPGEQAF
EKMIAGLYLGEIFRLIVVEMIEEGILFLGQNTYKIEKSFCFDTAFLSLIESDPTEELLTV
TGLFTHFFMLDTTISERQFFRRLAQLIGTRSARLSACGIAAIVSKTGMLDAGCGVATDGS
LYNKYPQFPERLHQALVDIFGEKGRGIKTYHAEDGSGVGSAIIAAMTKARLDEGTITQV
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgactacctccaattcaagtactgctaatcattctaactcaaatcattcaaaatcacaa
acagctgctcatcaacatcatcatcatcatcctcatggattcgatcctaatactcgaaag
agtgttaccatcagaagacgtagtggtagtcgaagtttagctgatggtagaggttcaatc
gtagttcatactagaactcacgagaatgctgaacttccacatgcgacaaagatgcaaatg
gcagactatttgcgcaagtttgagcatctcttcacggttactccccaaaggatgaggatg
attgtcgatgcgtttattgacactcttgaaattggtctcaaagaaaatggacaagctgtc
cccatgatacctacctatgtctttggctggccctcaggcaaagagactggtccttatctc
gccgtagatttaggtggaacaaatttgagagtttgtcatgttgaattagaaggcgaagga
aagtttgaaatcacccaagcaaagtacaaactaactgaagaacaaaagcaacaggaaggc
gagaaattgttcgacttttgcgcagaatgtttacacacatttatttacgaccaatatgcc
gatgaggccggtaacctgcaacttgaagaagagatcgccttagggtttacgttcagttat
ccttgcattcaaaagcggattgatcatggagaactcctgcgatggaccaaagggtttggt
aaccccaacgtggagggacatgatgtgggcgagatgtttgcaaaggcattgaagaaacac
aacgtacccatcaaactcacggctttgatcaatgataccactggcacgctcatcgcatca
tcctatgtagatccttcgacccgtattggcgtgatctttggtacaggctgcaatgcggct
tacatggagaaaatttccaacatccccaagatcgcccatcttggactccctcctgacgct
gagatggcaatcaattgtgaatggggtgcattcgatagcgagaaacatgagcatttacct
cgaaccaagtatgatctgatcattgatgaaacttccaataagcctggtgaacaagcattt
gaaaagatgattgctgggttgtacttgggtgagatctttcggttgattgtggttgagatg
attgaggaaggtatcttgttcttgggccagaatacctataaaatcgaaaagagcttttgt
ttcgatactgcgttcttgagcttgatcgaaagtgacccgacggaagaactcttgactgtc
actggcctctttactcatttcttcatgttggataccacgatttctgaacgtcaatttttc
cgccgattagctcaactcatcggcactcgtagtgccagattgtcagcatgtggaatcgcc
gctattgtctccaagactggaatgttggacgctggctgcggtgtagccactgatggtagt
ttatacaataaatacccccaattccctgaacgattgcatcaagccctcgtcgatatattt
ggtgaaaagggtcgaggaattaaaacatatcatgcagaagatggttcaggggtaggaagt
gcgatcattgcagcgatgaccaaagctagacttgacgaaggcacgattactcaagtgtga

DBGET integrated database retrieval system