KEGG   Melampsora larici-populina: MELLADRAFT_48897Help
Entry
MELLADRAFT_48897  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00730  Thiamine metabolism
mlr00790  Folate biosynthesis
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    MELLADRAFT_48897
   00790 Folate biosynthesis
    MELLADRAFT_48897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlr04147]
    MELLADRAFT_48897
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mlr00537]
    MELLADRAFT_48897
Enzymes [BR:mlr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MELLADRAFT_48897
Exosome [BR:mlr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MELLADRAFT_48897
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mlr00537]
 Enzymes
  MELLADRAFT_48897
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase
Motif
Other DBs
NCBI-GeneID: 18928561
NCBI-ProteinID: XP_007411598
JGI: Mellp1_48897
UniProt: F4RQZ9
LinkDB All DBs
Position
Unknown
AA seq 466 aa AA seqDB search
MISDGFGPASETFARGFVQHFEADTMSHLPLDPLLVGSSRTRSSNSLVTDSAAGATAFAC
GIKTYNGAISVEPVTQKPCGTVLEAAKHRGYLTGLVTTSRITHATPAAWYSHVVSRDMES
QIAPFLIGQGPLGSTVDLAFGGGRGFFMPKSFAGSSRSDEEDLLDLAKTKHNFNLLNDTR
AFEEQWRGGDGEIRTPVLALFNDNHMHYEIDRVSLDSTGLREPSLRNMSLAALQTLSRQA
HSQSAHGFFMMIEGARIDMAAHSNDPIGHLYDILAYQETVRTVKTWVDGWPTLMISVSDH
ETGGLALGRQLTSAYPEYAWYPEVLVNVTHSTAWLGDLIRNQTHPVSRQFLVETVLRDSL
GIQDASDKEIENIIQMSPGGNYDYALSDMVSRRAQLGWSTHGHSAVDVNLYAWPPELTEP
LRGNVENTYIGKFITDAMKIDLGVVTRDLNRFAFRVNGAYFMKLIM
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgatctctgacggctttggaccagcttctgaaacttttgctcgcggctttgttcaacac
tttgaggccgatacgatgtcgcatcttcccctagatccattactagtaggaagctctaga
actcggagtagcaattcactggtcaccgactcagctgcaggggctactgcttttgcctgt
ggcatcaaaacgtacaatggtgctatctcggttgagccggtaacacaaaaaccctgtggt
actgtcttggaagcagccaaacatcgcgggtatctaaccggcctggtcactacttcaaga
attactcatgcaaccccagctgcctggtattcacatgtagtatcacgtgatatggaaagt
cagatagccccgttcttgattgggcaaggtccgctaggatcgactgtcgacctggcattc
ggtggtggtcgaggattcttcatgcccaagtcatttgcagggtcaagtcgttcagatgag
gaggacctattggacttggccaagacaaaacacaatttcaaccttctcaacgacactcga
gcttttgaagagcaatggagaggaggagatggtgaaattcggacacctgtacttgctctc
ttcaatgacaaccacatgcattacgagatcgatcgggtctcacttgactccactggattg
cgagagccatcattgaggaatatgtctttagcagctctgcagacactttctaggcaagct
catagccaatcggcccacggcttcttcatgatgatcgagggagctcgcatagatatggcg
gcgcattcaaatgatcctatcgggcacttgtatgatattttggcatatcaagaaacagtc
cgaaccgtaaaaacatgggtagacggctggccaacactcatgatatctgtttcagatcat
gaaaccggtggccttgctctgggccgtcaattaacatctgcctatcctgaatacgcttgg
tatcctgaagttctagtgaatgtcactcattccactgcgtggttgggtgacctaatccgg
aatcaaacacatccagtctcgagacagtttctagtcgagactgtattgagagacagtcta
ggaattcaagatgcatcagacaaggagatcgaaaacatcattcaaatgtctcccggtggc
aattatgattatgccttgagtgacatggtgtctcgacgcgctcaacttggctggtctact
cacggtcattcagctgttgacgtaaatctttatgcttggccacccgaattgacggaacca
cttcgtgggaatgtggagaacacatacatcggaaagtttatcacggatgcaatgaagatt
gatctgggagtggtgacaagggatttgaataggtttgcttttcgcgttaatggtgcatac
ttcatgaagctgataatgtga

DBGET integrated database retrieval system