KEGG   Melampsora larici-populina: MELLADRAFT_50291Help
Entry
MELLADRAFT_50291  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00250  Alanine, aspartate and glutamate metabolism
mlr00410  beta-Alanine metabolism
mlr00430  Taurine and hypotaurine metabolism
mlr00650  Butanoate metabolism
mlr01100  Metabolic pathways
mlr01110  Biosynthesis of secondary metabolites
Module
mlr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MELLADRAFT_50291
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MELLADRAFT_50291
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MELLADRAFT_50291
   00430 Taurine and hypotaurine metabolism
    MELLADRAFT_50291
Enzymes [BR:mlr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MELLADRAFT_50291
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 18928690
NCBI-ProteinID: XP_007415910
JGI: Mellp1_50291
UniProt: F4S3H5
LinkDB All DBs
Position
Unknown
AA seq 514 aa AA seqDB search
MSLSKHVKPEQLLKSVKEHKHQKLTERENHHQVANAYGSRYLNQEVPKYQLPHTGINADA
AYQLIHDDLELDGRETANLASFVHTWAPAQATKLCMENIGKNLIDQDEYPQTQALHTRCV
SMLAHLWHAPESKNAIGTATTGSSEAIQLGGLAMKKAWQAKRKAAGKSIHEPGPNIVMGA
NAQVALEKFAAYFDVETRLVPVSEATNYCLDPKRAMEYVDENTIGVFVILGSTYTGHYEP
VKEMSDLLDAYEAETGISVPIHVDGASGAFVAPFAHPDLLWDFKIPRVVSINASGHKFGL
TYVGCGWVVWRDHAHLPKELVFELHYLGSVEYSFSLNFSRPAHPIINQYFNFIQLGFEGY
RGIALNDLSNARLLSRALERSGYYKVISDIHRKKTDVGKPRDQTHGCTDAQYEEFVPGLP
VVAFCWTDEFKAKYPGLKQKWIQTLLRARGWIVPNYELPPELEKQEILRIVVRESFSQEL
VDNVVVSIMEVTEALVSNLTRSFYRLKESTSYDI
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtctttatcaaaacatgtcaagcccgagcaacttctcaaatctgttaaagaacataaa
catcaaaaattgactgagagagagaaccatcatcaggttgcaaacgcttacggctctcgg
tatttgaaccaagaagtaccaaagtaccaactcccacacacaggtatcaatgcagatgcg
gcctaccagcttattcatgacgaccttgaattggatggaagagagacagcaaatttggct
agttttgttcacacctgggctcccgctcaagccactaagctttgtatggagaatattgga
aaaaatcttattgaccaggacgaatatccccaaacacaggctcttcacacgcgctgcgtg
tcaatgctcgcgcatttgtggcacgcaccagaatctaaaaatgcgattggaacggcaacc
acgggatcatctgaagctatccaattaggtgggttggccatgaagaaagcctggcaagcc
aaacgcaaagcagctgggaaatctatccatgaaccagggcctaatattgtgatgggagca
aacgctcaggtcgctttagaaaaatttgcagcttacttcgatgtggagacgagactagta
cctgtgtcggaagcaactaactactgccttgatcccaaacgggctatggaatatgttgac
gagaacaccataggagtattcgtgattctcggaagtacctatactggtcattatgaacca
gtcaaagagatgtcagacctgctcgacgcctatgaagctgaaacgggtatatcggttcca
atccatgtggatggagcgtcaggagcttttgtcgcaccgtttgctcatcctgatttatta
tgggacttcaagattcctcgagtggtttctatcaacgcctctgggcataagtttggcctc
acctacgtaggctgtggttgggtggtctggcgtgatcacgcacacttacccaaagaattg
gtttttgaattacattatttgggatcagtggaatattcattttcgttgaatttctcacga
ccagcacatcctatcatcaaccaatatttcaactttatacaactcggatttgaaggatat
cgagggattgccttgaatgatctgtccaatgctagattattatctcgggccttggaaaga
agtggatattataaggtgatatccgatattcaccgcaagaagactgatgttgggaaacct
cgcgatcaaacgcatggctgtactgatgctcaatacgaggaatttgtccctggattgcct
gttgttgccttttgttggactgatgaattcaaagccaagtatcccggcttgaagcaaaaa
tggattcaaacgttgttgcgcgccagaggatggattgtgccaaattatgaactcccccct
gagcttgaaaagcaagagattctacgaatcgtcgttagggaatctttctctcaggaactc
gttgataacgtcgttgtttcaattatggaggttacagaagccctggtgagcaaccttacc
cgctctttctaccgactaaaagagtcgacatcgtatgatatctaa

DBGET integrated database retrieval system