KEGG   Melampsora larici-populina: MELLADRAFT_50486Help
Entry
MELLADRAFT_50486  CDS       T03138                                 

Definition
(RefSeq) family 3 glycosyltransferase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00500  Starch and sucrose metabolism
mlr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MELLADRAFT_50486
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mlr01003]
    MELLADRAFT_50486
Enzymes [BR:mlr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MELLADRAFT_50486
Glycosyltransferases [BR:mlr01003]
 Polysaccharide
  Storage polysaccharide
   MELLADRAFT_50486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_trans_1_4 Glycos_transf_1 Glyco_transf_5 Glyco_transf_4 Glyco_trans_4_4 DUF1978
Motif
Other DBs
NCBI-GeneID: 18928708
NCBI-ProteinID: XP_007416527
JGI: Mellp1_50486
UniProt: F4S591
LinkDB All DBs
Position
Unknown
AA seq 730 aa AA seqDB search
MSPPGVRDVHNHLLFEIAWEVANKVGGIYTVIKTKAPVTCQEYGDRYCLMGPLSYKSAPM
EVEAMEPETPELRDSLQSMRDRGVKYLYGRWLIEGGPRVLLFDTGCVMNRLDEWKSDLWN
LAGIPTPPNDSETNDTIVFGYLVAWFLGEFASRETSKAIVGHFHEWLAGLAIPLCRKRHI
DITTIFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCVERAATHCADVFT
TVSHITAYESEHLLKRKPDGVLPNGLNVVKFSAMHEFQNMHAMAKQKINDFVRGHFYGHY
DFDLENTLYFFTAGRYEYRNKGVDMFIESLARLNHRLKAMGSKMTVVAFIIMPASTHSYT
IEALKGQAVTKQLRDTVTEIQNRIGNRLFEMTARYTGTIGTEVPDASTLMSNEDKILLKR
RVFALKRNSLPPVVTHNMSDDSSDPILNQIRRVQLFNGSSDRVKVIFHPEFLNSNNPILG
LDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCFMDELIENPQEYGI
YIVDRRMKSVEDSVNQLTDQMYDFCTKTRRQRINQRNRTERLSDLLDWKSLGLEYSKARQ
LALRRAYPDSFQAEDEDEFEKSLAKLGRPLSAPGSPRYRSGMMTPGDIGTLTEDMEGLGT
SDYMGNARWGTTSTMNPEDEEGGYPFPLVLKRRAGSVGLASGQTTPGVSGSFKTLSEGDL
KKADEALSGH
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctccacctggtgttcgagatgttcataaccatcttctctttgagatcgcttgggaa
gttgctaacaaagtcggaggaatctacaccgtcatcaagacaaaggcaccagtgacctgt
caagagtatggggaccgttactgtcttatgggacctctttcctataaatcagccccaatg
gaagttgaagccatggaaccggagacccccgagttgagagactcgctgcaatcgatgcgc
gatcgaggggtaaagtacctctacgggcgttggttgatcgaaggtggacctagagtctta
cttttcgataccggttgtgtgatgaaccgattggatgaatggaagagtgacctatggaat
ctagcgggaattccaacacctcccaatgacagtgagacgaacgacacgattgtctttggc
tatcttgtggcttggtttttgggagaatttgcatcccgtgaaacatcaaaggccatcgtc
ggtcattttcacgagtggttggccggactagccatcccactctgtcgcaaacgtcatatt
gacatcaccacgatcttcactactcacgcgaccttattgggccgatatctctgtgctgga
tcggtagacttttacaacaacctacaatactttgatgttgaccacgaggccggaaaacgt
gggatctatcaccgatactgtgttgaaagagctgcaacacattgtgcggatgtctttact
accgtctcgcatatcacagcttacgagagcgagcatttgctcaagaggaaacctgatggg
gtcttgcctaatggtctcaacgtggtcaagttctcggccatgcatgaattccaaaacatg
catgctatggctaaacaaaagatcaacgactttgttcgcggtcacttttatggccattat
gattttgacctcgaaaacactctttacttcttcacggctggaagatacgagtatcgtaac
aagggagtggatatgtttattgaatctttagctcgtctcaatcatcgattgaaagcgatg
ggatccaagatgactgtggtggcatttatcattatgccagcctcaacgcactcctacaca
attgaagctttgaaaggacaagctgtcactaaacaacttcgggacacggtaacagagatt
cagaaccgaatcgggaatcgcttgtttgagatgaccgctcgatacaccggaacaatcgga
accgaagttccagatgcctcaactctgatgtcaaatgaagataagatcctactcaaacga
cgagtttttgccctcaagagaaactcactcccaccagtagtgactcataatatgtcggat
gatagtagtgatccaattttaaatcagatcagacgtgttcaattgttcaatggaagttcg
gatcgcgtcaaagtgatcttccatcctgagtttctcaactcaaataatcctattcttgga
ctcgattatgaagagtttgtacgtggatgtcatcttggcgtctttccttcgtactacgaa
ccctggggttatacaccggcagaatgtaccgtgatgggtgtaccaagtatcaccactaat
ttgtccggttttgggtgcttcatggatgagttgatcgaaaacccacaagaatatgggatt
tacatagttgatcgacgcatgaaatcagttgaggattcggtcaatcaactcacagatcaa
atgtatgatttctgtaccaagactcgacgacaacgtatcaaccaacggaatcggactgaa
cgactatctgatctgttagattggaaatcacttggtttagaatactccaaggctcgtcaa
cttgctctcaggcgagcttatcctgatagcttccaggctgaggatgaagatgagtttgag
aagagcttggctaagttgggaagacctctgagtgcacctggtagtccgaggtatcgatct
gggatgatgactccaggtgatattggaactttaacagaggacatggaaggtttggggacg
tcagactatatgggtaatgcacgctggggtactacctcgactatgaatcctgaagatgaa
gaaggaggttatccattcccattggtacttaaacgtcgagcaggttcagttggacttgca
tcaggtcaaactacaccaggagtgagtggatcgtttaaaactttaagtgaaggagattta
aaaaaggctgatgaagctttaagtggacattaa

DBGET integrated database retrieval system