KEGG   Melampsora larici-populina: MELLADRAFT_72134Help
Entry
MELLADRAFT_72134  CDS       T03138                                 

Definition
(RefSeq) Mn superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mlr  Melampsora larici-populina
Pathway
mlr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mlr00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    MELLADRAFT_72134
Enzymes [BR:mlr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MELLADRAFT_72134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N DUF2807
Motif
Other DBs
NCBI-GeneID: 18932019
NCBI-ProteinID: XP_007411402
JGI: Mellp1_72134
UniProt: F4RQ24
LinkDB All DBs
Position
Unknown
AA seq 236 aa AA seqDB search
MFKTGITKSVRIGSSLNLRTPNLGASRSTSFLTFNRGNHTLPNLPYAYNALEPAISEQIM
ELHHSKHHAAYVNGLNAAEEAYASALKSNDALKQIELQAQIKFNGGGHINHSLFWKNLQP
EKSGGGQLKDGAFAKAVQEQYGGLEKLKANMNAAAMGIQGSGWAWLAVNIKEKKLTITST
GNQDPLTAPLVPIIGIDMWEHAFYLQHQNRKADYLTNIWKVINFEEAEARYKSATA
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaccggtattactaaatctgttcgaatcggatcttctctcaaccttcgaact
cccaatctcggtgcttctcgatcaacctcattcttgacctttaacaggggaaaccacact
ttacccaatttaccctatgcatacaatgcgctcgagcctgcaattagcgagcaaatcatg
gagcttcatcactcgaagcatcatgcggcatacgtcaacggactcaatgctgccgaagag
gcttacgcgtcagctttgaagtccaatgatgccttgaaacagattgaacttcaagctcaa
atcaaattcaacggtggtggccacatcaatcactctctcttctggaagaaccttcagcct
gagaagtctggaggtggccaattgaaagatggtgcctttgctaaagctgtgcaagagcaa
tacggcggattagagaaattgaaggctaacatgaacgcagctgcgatgggaatccaaggg
tctggttgggcttggctggctgtcaacatcaaggagaagaagttgaccatcacctccacc
ggcaatcaagatccactcactgccccacttgtcccaatcattggtattgacatgtgggag
catgcgttctaccttcaacaccaaaaccgaaaggctgactacctaaccaacatttggaaa
gtcatcaactttgaagaagctgaggcccgttacaaatctgcaacagcctga

DBGET integrated database retrieval system