KEGG   Melampsora larici-populina: MELLADRAFT_72597Help
Entry
MELLADRAFT_72597  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mlr  Melampsora larici-populina
Pathway
mlr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mlr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MELLADRAFT_72597
Enzymes [BR:mlr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     MELLADRAFT_72597
Transporters [BR:mlr02000]
 Other Transporters
  Pores ion channels [TC:1]
   MELLADRAFT_72597
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_N_2 GST_N_3 GST_C_2 MetRS-N
Motif
Other DBs
NCBI-GeneID: 18932142
NCBI-ProteinID: XP_007413472
JGI: Mellp1_72597
UniProt: F4RWE1
LinkDB All DBs
Position
Unknown
AA seq 227 aa AA seqDB search
MSHGKQFTLYSIIGGTNGTKVTYLLEELGLTYDTIYLDYRKDEQKSPDHIKLNPNGRIPT
IIDHQNSDFSLWESNAILQYLVDKYDKEDKFSVTKPEDKHIQSQWLYFQASGQGPYFGQL
GWFKLYHPEKFDSAIERYEKEVKRVFGVLESVLSKQDWLVGGKYTIADLSFLAWHNMAVK
FLLDNYDCAKEYPSLDKWAKRMDERPAIKKVNAHLEALKKAQDSKEG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatgggaagcagttcacgctttatagtatcattggtggcacaaatggaacaaag
gtgacctacctgctcgaagagcttggactaacttacgataccatctatctggactaccga
aaagatgagcaaaagtctcctgaccatatcaagctcaatcccaatgggcgaattcctacg
atcattgatcatcaaaactcggatttctcgttatgggaaagtaatgcaatactccaatac
ttagtagataaatacgacaaggaagacaagttctcagtgacgaaaccagaagataagcac
atacaatcacaatggctatacttccaagcttctggacagggcccttactttggtcaatta
ggatggttcaagctctatcaccctgaaaagtttgattctgctatcgaacgctatgaaaag
gaagtcaagcgagtgtttggtgtcttggaaagtgttctgagcaaacaggattggttggtc
ggtggtaaatacactatcgcagacttgtccttccttgcttggcacaacatggctgtgaag
tttctacttgacaactatgattgtgcaaaggaatatccctcactcgacaagtgggcgaag
agaatggatgagcgaccagcaattaagaaggtcaatgcgcatctggaagctctcaaaaaa
gctcaggattcaaaggaaggctag

DBGET integrated database retrieval system