KEGG   Melampsora larici-populina: MELLADRAFT_76882Help
Entry
MELLADRAFT_76882  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
Organism
mlr  Melampsora larici-populina
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 18932851
NCBI-ProteinID: XP_007406056
JGI: Mellp1_76882
UniProt: F4R9U8
LinkDB All DBs
Position
Unknown
AA seq 1174 aa AA seqDB search
MSTPTRPPSRYAAEPKPGEALLQSAGYTHLLLVGQAKDLPTLSASPVWRKASQLQETIGS
VSHYLFSRGSSNSGLNNEDEVALTDSKTPTSLIFLSVQQLLSGRIPENLSMIINILSSVG
KPLDDRKMQLEDVVGWLATSGRKNQHAPNKMVNDVQGQFIDILWNDLSHPSTVDLNPKHR
FRTPDGRNNNIIGSPFLGAANQPYARSVKALHPRAPYVAEPEEMFDSILRRPEGFEGFVP
HPAGISSLLFGFANIIIHDIFWTNTGPEVKGPGSDTDSNQYGDSGNGSSRASQWQNLTSS
YLSLDPLYGVGQEEQDKIRNKEDLGRGLLYNDTFASSRLLVMPPASCALLVIFSRNHNRV
AKRLLEINERKTWTADLEKLSPEQLQQQDDEIFGTARLINCGYYVEMILHDYLSAILNTT
QADSDWALDPRAPIKSILGSTPKATGNSVTVEFNSLYRWHAPMSWSQSKWIEKWEDVNHE
TIKKSAALLKKELNAEDGVEPRYWKLSKYEVNVPRSGQPELTSAGVYERDSETGEFRDED
IAKILKDSTYEVAGTFGARHIPAAMRWIECQGMRTSRDVWKTCTLNEFRAFLGLKEFESF
EEWNSDPSVASAMQDLVGHPANIPLHVGLHGEEAKKPRLGAGLCPNYTNSRAILSDAVSL
VRGDRFYTDSATADTMTDWGLRDCQPDVQEGAYGGMLQKLIRNNLPDQYVFNDVALLFPF
KTPQSSYSILEKIGPQKALQYSLQPTPTPHLSLGYKHIQSGGKTMVYEISDTPKVEVERM
SLLFGLPKMNSNIKLIYQAVEMAMSRQNSEQYKLFIQSRIQQCSARRSPVSTDETVDVAR
DVTNPLICGWLSHIFGLVETGIHSQQLLLCALSDIYCYLNAHDQISFKSRASARVAASGF
AWQIKQHIEASSPPNSIGNLIRRGVSKLTIGAIDVLEDSIKTISGQRPDIKHTSPDTKIF
YDTIRVENDAQRIPLSIDELTADCLRAVSTLAYTIVNGTAHALDYLMPATTTHADEIPKL
RQTLHDLVHNPRFDRSNIHEAHLKHGLEGVRLAHWNPYLRAISFGVKLEHRAHPRPIGII
DREFRLDRNTLEYLRLLDVEGYCLPMFEIILPVIINQVFSLNKVQRAPGMQGRLEKIMIT
GTSASIPTMHIRYDGSKTLKAINSLRGRRTNGIA
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgtccacacccactagaccccctagccgttatgctgccgaacccaaaccaggtgaagct
cttctgcagagtgcagggtacactcatctgttacttgttggtcaagcaaaagacttgccg
acgttgagcgcttcgcctgtctggcgcaaagcctctcaattgcaggagaccattggctcc
gtgtcacattacctgttctccagaggtagctcaaatagtggtctcaacaatgaagacgag
gtggcgctcaccgacagcaaaactccaacttcgctcatattcctcagtgtccaacaactt
ttgtctggtagaattcctgaaaacctttccatgataataaacattttgtctagtgtaggt
aaacctctagatgatagaaagatgcaactggaagatgttgtgggttggttagccacgtct
ggtagaaaaaaccaacatgcacccaacaagatggtgaatgacgtccaaggtcaattcata
gatatactctggaatgacctctcgcatccatcaactgttgatctgaatcccaaacatcgc
tttagaacgcccgatggtcggaacaacaatatcattggttccccatttcttggtgctgcc
aatcaaccctatgctagatctgtcaaggcacttcaccctcgcgcaccttacgtcgcggag
ccggaagagatgttcgattctatcctgcgtcgtcccgagggttttgaaggttttgttcct
catcctgctggaatatcaagtctcttgttcggctttgccaacatcatcatccatgatatc
ttctggactaacactggtccagaagttaaaggtccgggatccgataccgattcgaatcaa
tacggtgacagcgggaatggatcctcgcgtgcaagccaatggcaaaatttgacatcctct
tatctttccttggatcctttatacggagtcggacaagaggaacaagacaagattcgcaac
aaagaggaccttggccgcggcttgttgtacaatgacacttttgcatccagtcgattactt
gtgatgcctccagcatcgtgtgctctacttgtaatcttttctagaaaccataatcgagtt
gctaaaaggcttctggagatcaatgaacgcaaaacttggacagccgatttggagaaactc
agtcccgagcaattgcagcaacaagacgatgagatttttggcaccgccagattgatcaat
tgcggctattatgtagagatgattctccacgactatctcagcgctatcttaaacactaca
caagccgacagtgactgggcgctcgaccctagagctccgatcaaaagtatcctcgggagt
acccctaaggctactggaaactcagtcacagttgaattcaattctctatatcgctggcac
gctccgatgtcgtggtcccaaagtaaatggatcgagaaatgggaggacgtgaatcatgag
accatcaaaaaatcagccgccttattgaagaaggagcttaatgctgaagacggggtagag
cctagatattggaagttatctaaatacgaagtcaacgttcctagaagtggccaaccagag
ctgacctccgcaggagtttacgaaagggactcagagaccggtgaattccgtgatgaggac
attgcaaagattttgaaagattctacgtacgaagttgctggtactttcggagcacgccat
atacctgcagccatgagatggattgaatgtcaaggaatgcgaacttctagagatgtgtgg
aaaacctgcaccctgaatgaattcagagcttttctgggtttgaaggaatttgaatcattt
gaggaatggaattcggatccttctgtggcttctgctatgcaggatcttgtcggccatcct
gcgaacattccattacatgttggtttgcatggtgaggaagctaagaagccaagattagga
gcagggttgtgtccaaattacacaaacagtcgggctatcttgagtgatgcagtttccctt
gttcggggagatcggttctacacggactctgcaactgccgacactatgacggattggggc
ctgcgtgactgtcaaccggacgttcaagaaggggcttacggtggcatgttgcaaaaattg
atacgcaataacttgccggatcaatatgtattcaacgacgttgctctactatttcctttc
aaaacccctcaaagttcctactcgattctggagaaaataggccctcaaaaggccctgcaa
tattcgcttcaacctactcctactccacatttgtccctaggttacaaacacatacaatcg
ggcggaaaaacaatggtctatgagatttctgacactccgaaagtcgaagtagaaagaatg
agcttgctttttggtttgccaaagatgaattcaaacatcaagcttatttaccaggcagtt
gagatggcgatgtccagacaaaactccgaacagtacaagttgttcattcaaagtcgcatc
caacaatgttcggccagacgaagcccagtgtctaccgatgagactgtcgatgtagcgcgg
gacgtgaccaacccattgatatgtggatggctttctcatatctttggacttgtggaaact
gggattcactcgcagcagcttctcctctgcgcattaagcgacatctattgctatctgaat
gcacatgaccaaatctccttcaaatccagagcttctgctcgtgtcgccgcttcgggtttt
gcttggcaaatcaaacaacatattgaggcatcttcacctcccaattcgatcggaaatttg
atcagaagaggagtttctaagctcaccataggtgcaatcgatgtcctcgaggattccatc
aagaccatatctggtcaaagaccggatatcaagcatacttctcctgacaccaagatcttc
tatgataccataagagtagagaatgatgctcaaagaatcccactttctattgacgagctc
acagccgattgcttgcgagccgtctcaaccttggcatacactattgtcaacggtacagcg
catgcgttagactatctgatgcccgctacaacgacccacgcagatgagattcctaaactt
cgacaaacgttacacgacttggtccacaacccccgcttcgaccgatcgaacatacatgag
gctcatctaaagcatgggttggaaggtgtgcgattggcccattggaatccttacctgcga
gctatatcgtttggcgtaaaacttgaacacagggcccatcctcgtccgatcggcatcatc
gaccgtgaatttcgactcgaccgaaacactttggaatacttgcgattattagatgtcgag
ggctattgcctccctatgtttgagattattctgcccgtcatcatcaatcaagttttctct
cttaacaaggtccagcgtgcaccaggtatgcagggtaggttggagaagatcatgatcacg
ggtacctccgcgtccataccgaccatgcacattagatacgatgggtccaaaaccttgaag
gcgataaacagcctccgaggcagaagaacaaatggtattgcgtga

DBGET integrated database retrieval system