KEGG   Melampsora larici-populina: MELLADRAFT_88034Help
Entry
MELLADRAFT_88034  CDS       T03138                                 

Definition
(RefSeq) hypothetical protein
Organism
mlr  Melampsora larici-populina
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 18934741
NCBI-ProteinID: XP_007411385
JGI: Mellp1_88034
UniProt: F4RQ62
LinkDB All DBs
Position
Unknown
AA seq 315 aa AA seqDB search
MSTIYQDCPYFPELAEYVQAVAGASLQISRELREGRADIGMVWDGGRHHAQQAKASGFCY
VNDIVLAIMELRRPPIDKTQTKIDRVLYLDLDVHHGDGVEMAFHSTSRVLTVSIHCHDPE
GGFYPLTGSSSDSGPSPPSPASSHALNIPISSPGQLTHVSSQFLLPIINLYKPDAVVVQC
GVDGLAGDPIGGSHWGLGLEEMGNCLNDIIRQSRLIKCKVLLLGGGGYRRANAARAWAYF
TSIALARTCSLSTDIPSEVDIYMEYGPSFTLDVPALHSSKFLSSTKSDEEFQKTCSSIKP
HLEILEARYTKLELK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgtctactatctatcaggattgtccatattttcctgaattagcggagtacgttcaagca
gtggctggggcttcacttcaaatctcacgcgaactacgtgaaggacgagccgatatcggt
atggtttgggatggcggtcggcatcatgcccaacaagcaaaggcatccggtttttgctat
gtcaatgacattgttttagcaatcatggaacttcgtcggccaccaatagacaagactcaa
actaagattgatcgagttttgtatcttgatttagatgttcatcatggtgatggcgtagag
atggcttttcattcaacttcacgcgtcttgactgtctcaattcactgtcatgatccagaa
ggtggattttatccgcttacaggcagttcttctgactcaggtccctcccctccttcacct
gcttcctcgcatgcactcaacattcctatctcgagccctggtcaacttactcatgtctct
tcacaattccttctacccatcatcaatctctataagccggacgctgtagtggtacaatgt
ggagtagatggattggctggtgatccgataggtgggtctcattggggacttgggcttgaa
gagatgggaaattgcttgaacgatatcattcgtcaatctaggttgataaagtgtaaagtt
ttgctattgggaggaggaggttatcgtcgtgcaaatgcagctagggcatgggcttacttc
acatccattgctcttgcacgaacttgttcattgagtacagatattccctcagaagttgat
atctatatggaatatggtccttcctttactcttgatgtccctgctcttcattcatcaaaa
ttcctttcaagcaccaaaagtgatgaagagtttcaaaaaacatgttcttcaatcaaacca
catttggaaatattggaggccagatacaccaagttggagctcaaatga

DBGET integrated database retrieval system