KEGG   Methanosarcina lacustris: MSLAZ_0165Help
Entry
MSLAZ_0165        CDS       T03822                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mls  Methanosarcina lacustris
Pathway
mls00630  Glyoxylate and dicarboxylate metabolism
mls01100  Metabolic pathways
mls01120  Microbial metabolism in diverse environments
mls01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSLAZ_0165
Enzymes [BR:mls01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSLAZ_0165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB73426
UniProt: A0A0E3S0F6
LinkDB All DBs
Position
complement(207810..209096)
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDIGYSPKDTDLICEFHIEPSAGVNFEEAATHMAGESSIDSWTEISTLSPELAAK
LKPHVFYLDEESQTVRVAYSEDLFELGSVPQVLSAVAGNIFSMKIVDNLRLQDIAFPGSM
LREFKGPNFGLPGIRKLVGVYDRPLIGTIVKPKVGLTSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNGFDRRAELTLKIAEKAEVETGEKKMYLCNITAPTCKEMTRRLNVLKDLGASY
AMIDIVPVGWTALQTLREEAEDAGLALHAHRCMHSAYTRNPRHGMSMVLVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLSLRDECVLGKVPADETQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTAAGATACRQALDASLEGVSMQDYAKNHTELEA
AIGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagggactacatagatatcggctacagcccgaaggatacggatctgatttgtgaa
ttccacattgaaccatcagcaggagtgaattttgaggaagctgccacccacatggcaggg
gaaagctctatagattcctggactgagatttccacattgagtcccgaacttgcagcgaaa
ttaaaacctcacgttttttacctggacgaagaatcacagaccgtaagggtggcttattcg
gaagatctttttgaactgggttcggttccccaggtgctgagtgctgttgcaggaaacatc
ttcagtatgaaaatcgttgacaacctcaggctgcaggacatcgccttccccgggtcaatg
ctccgcgagttcaaaggtccgaacttcgggctgccggggatcaggaaacttgtaggtgtg
tatgaccgcccccttatcgggactatcgttaaaccgaaggtaggcttgacctcagagaaa
catgcggaagttgcgtacaattcttttgccggaggctgcgacctcgtaaaagatgatgag
aaccttaccgaccagaagttcaatggctttgacagaagggctgaactcaccctgaaaatt
gcagaaaaagctgaagtagagaccggggagaagaagatgtacctctgcaacatcacagcc
ccgacctgtaaggaaatgacccggcgcttaaatgtcctcaaagacctgggggccagctat
gcaatgatcgatatcgtgccggtaggctggactgctcttcagaccctgcgggaagaggct
gaagatgcgggtcttgcccttcatgcccaccgctgcatgcattcagcgtacacccggaac
ccccgccatgggatgagcatggttctcgtcgccaagctctgcaggttgatagggcttgac
cagctccacataggcacggttgtcgggaaaatgcacggagaaaaacatgaagtcctgtct
ctaagggatgagtgtgtgctcgggaaagtacctgcagatgaaacccagcatgtccttgcc
caggactggggaggattaaagccaatgttcccggtagcatccggagggctcgctcctaca
atgattcctgatctttattctatctttggaaaagatgttattatgcaattcggtggcgga
atccatgcgcatccgatgggtacggcagccggagctactgcctgcaggcaggcccttgat
gcaagccttgaaggagtcagcatgcaggactatgcaaagaaccacaccgaacttgaagct
gctatcgggaagtggcttaagaaataa

DBGET integrated database retrieval system