KEGG   Methanosarcina lacustris: MSLAZ_1418Help
Entry
MSLAZ_1418        CDS       T03822                                 

Definition
(GenBank) Tungsten-containing aldehyde:ferredoxin oxidoreductase
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
mls  Methanosarcina lacustris
Pathway
mls00030  Pentose phosphate pathway
mls01100  Metabolic pathways
mls01120  Microbial metabolism in diverse environments
mls01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MSLAZ_1418
Enzymes [BR:mls01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     MSLAZ_1418
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: AKB74679
UniProt: A0A0E3S1U4
LinkDB All DBs
Position
complement(1804250..1806073)
Genome map
AA seq 607 aa AA seqDB search
MLGGYTGKILEVDLDSGELKDSPLDEEMAKMYLGGKGLGLKLVYNEFRPDMQPFDPDNLL
VFATGPATGQKVPTSGRYHIVCSKSPQTGTVGSGNAGGKWGPFLKFAGYDVVIVRGISKE
PVYLSIVDGKAKLVPAPELWGMTVHAVTDELTERTGDPKKTSVACIGPAGENLVPFSGIM
NDKYRTAGRTGLGAVMGSKKLKAIVVSGSQRVEPANPELLKERVVESMAKIKENPITGPK
GGLHTYGTAVLVNILNESGAYPTRNFQEAYFPDADEQSGETLVKKYLTGRGGCWGCPIVC
GRKSDVPEGPYSVRDTEGPEYETIFAFGADCGITELDALVKANHLCDELGLDTISMGGTI
ACAMELVEKGKIPAEKLYGMNLRFGDPGSMIEAIWRTAYRAGIGADLALGSRALAEKYGA
PEFSMAVKGMELPAYDPRSIQGIGLNYATANRGGDHVYGYMISPEILGLPLKLDPYAVED
KPKWTIILQDLTSAINSSVVCLFTSFALGLPEYAGMMAAITGFDLDADKLLKLGERVTNL
ERLMNNRYGLDRNEDILPKRLTEEPIPSGPSKGQVSHVPEMIDEYYRLRGWVDGKPTEEK
LKELGIV
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgcttgggggctatactggaaagattctggaagttgaccttgacagcggcgagcttaaa
gactcaccgcttgatgaagaaatggcaaagatgtaccttggaggcaaagggctcggcctg
aaactcgtatacaatgagttcagaccggacatgcagccctttgaccctgataacctgctt
gtgtttgcaaccggacctgccacaggacagaaagttcccacaagcgggcgttaccatatc
gtatgcagcaaatctccgcagacagggaccgttggaagcgggaatgcaggaggaaaatgg
gggcctttcctgaagtttgcgggttatgacgtagttattgtccggggaatttcaaaagag
ccagtctacctgagcatcgtggacggaaaagccaaacttgtgccagctccggaactctgg
ggaatgacagtccatgcggtaacggacgagctgactgaaaggacaggagatccgaagaaa
acctcagttgcctgtatcggacctgccggagaaaaccttgtccccttttccggaattatg
aacgacaagtacaggaccgcaggcaggaccgggcttggggctgtcatgggcagcaagaaa
ttaaaggcgatcgtggtttccgggagccagagagttgagcctgcaaaccccgaactcctg
aaagagcgggtagtcgaatccatggcgaaaatcaaggaaaatccgattacgggcccaaag
ggaggacttcacacatatgggactgcggttcttgtgaatatcctcaacgaaagtggggct
tatccgacccggaacttccaggaagcctacttccctgatgccgacgaacagagtggagag
accctggtcaaaaagtaccttacaggtcgtggagggtgctggggctgcccgattgtctgt
ggaagaaagtccgatgtacctgaaggtccctacagtgtccgggataccgaaggcccggag
tacgaaaccatctttgcattcggtgccgactgcgggataacggagcttgacgctctggta
aaggccaaccatctctgcgacgaactggggcttgacaccatctccatgggaggcacgatt
gcctgtgctatggaactcgtggagaaaggaaaaatcccggcagaaaaactgtacggcatg
aacctgcgctttggagatcccggttcaatgatcgaagccatctggaggaccgcctatcgt
gccggaatcggagctgaccttgccctgggctcgagagcgcttgccgaaaaatacggagct
ccggaattctccatggctgtcaagggcatggaactgcccgcatatgacccccggtccatc
cagggaataggcctgaactacgcaaccgcaaatcgcgggggtgaccacgtctacggctat
atgatctcccctgaaatcctggggcttcccctaaagcttgacccctacgccgttgaggac
aagccgaaatggaccatcatccttcaggaccttacctccgccatcaattcgtcggttgtc
tgcctctttacttcgtttgccctgggtctgcccgaatatgcggggatgatggcagcgatt
actggctttgaccttgatgccgacaagcttctgaagctcggagagagggtcacaaacctc
gagcggctgatgaacaacaggtacgggcttgaccgaaatgaagacatcctcccaaagcgt
ctcactgaagaaccgataccgtccggaccctcaaaaggccaggtttcccatgtcccggaa
atgatcgacgaatactacaggctcaggggctgggttgatggaaagcccacggaagagaag
ttgaaggaactcgggatagtttga

DBGET integrated database retrieval system