KEGG   Muricauda lutaonensis: VC82_1279Help
Entry
VC82_1279         CDS       T03884                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
mlt  Muricauda lutaonensis
Pathway
mlt00240  Pyrimidine metabolism
mlt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlt00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    VC82_1279
Enzymes [BR:mlt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     VC82_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AKA34909
UniProt: A0A0D5YSM5
LinkDB All DBs
Position
1360317..1360961
Genome map
AA seq 214 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPIVDTRYNEEM
VVSHDANEIRSTPVPAAANIRLLADDCDVVGIDEAQFFDDEIVTVCNDLANRGVRVVVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKSNDDKLVLLGETEEYEP
LSRAAFYKAMLKEKLNKMDVEVEEVVANKKAANG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaacacggtcaatcataaagaacagttcgggtggatagaggtcatctgt
gggtctatgttctcaggtaagaccgaagagttgatccgacggttgaaacgtgcccaattt
gccaagcaaaaggttgaaatattcaaacctattgttgatactcgctataacgaggaaatg
gtggtgtcccatgatgccaatgaaattcgctctacccctgtgcccgctgccgcaaacata
cggctgttggccgatgattgtgatgtggtcggcattgacgaggcccagttttttgatgat
gagatagttaccgtgtgcaacgatcttgccaataggggggtccgtgtggtggttgcggga
ttggatatggactttaaaggaaatccgttcgggccgatgcctgccttaatggccactgcc
gaatatgtaaccaaggtacatgccgtgtgtacccgcaccggaaaccttgccaactatagt
tttcgaaaatcgaatgacgacaaactggtgcttttgggcgaaaccgaagagtacgagccc
ttgagccgggcagcattctacaaggccatgttaaaagaaaaactgaataagatggatgtc
gaggtggaagaagtggtagccaacaaaaaagctgcaaatgggtaa

DBGET integrated database retrieval system