KEGG   Muricauda lutaonensis: VC82_2248Help
Entry
VC82_2248         CDS       T03884                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
mlt  Muricauda lutaonensis
Brite
KEGG Orthology (KO) [BR:mlt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:mlt03012]
    VC82_2248
   03029 Mitochondrial biogenesis [BR:mlt03029]
    VC82_2248
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlt04147]
    VC82_2248
Translation factors [BR:mlt03012]
 Eukaryotic Type
  Elongation factors
   VC82_2248
 Prokaryotic Type
   VC82_2248
Mitochondrial biogenesis [BR:mlt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VC82_2248
Exosome [BR:mlt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VC82_2248
  Exosomal proteins of breast cancer cells
   VC82_2248
  Exosomal proteins of colorectal cancer cells
   VC82_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: AKA35839
UniProt: A0A0D5YVB9
LinkDB All DBs
Position
2380395..2381582
Genome map
AA seq 395 aa AA seqDB search
MAKETFDRSKPHLNIGTIGHVDHGKTTLTAAITKVLADEGLSETRSFDSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRIVVFLNKVDMVDDEELLELVEMEVRELLSFYEYDGDNGPVIAGSALGALN
GEEKWVKSVKDLMEAVDTWIELPERDVDKDFLMPIEDVFTITGRGTVATGRIETGVAKTG
DPVEIIGMGAEKLTSTITGVEMFRKILDRGEAGDNVGILLRGIEKTDIKRGMVICKPGSV
TPHAKFKAEVYILKKEEGGRHTPFHNNYRPQFYVRTTDVTGNINLPDGVEMVMPGDNLTI
TVDLIQPIALNVGLRFAIREGGRTVGAGQVTEILD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaaactttcgatcgttccaaaccgcacttgaatattggtactattggacac
gtggatcacggaaagacaacattgactgccgctatcactaaggtgttggctgacgaaggt
ctttcagaaacaagaagctttgattctattgataacgctcctgaagagaaagaaagaggt
attactatcaacacttcacacgtggagtaccaaacagccaacaggcactatgcgcacgta
gactgccctggtcacgccgactatgtaaagaatatggttacaggtgctgcccagatggac
ggtgccattttggtggttgctgctaccgatggtcctatgccgcaaactcgtgagcacatt
cttttgggtcgtcaggtaggtatcccacgaattgtagtgttcttgaacaaagttgacatg
gttgacgacgaagagttgttggagcttgttgagatggaagtaagagaattgctttctttc
tatgagtacgacggtgacaacggacctgtgattgcaggatctgcacttggtgctttgaac
ggagaggaaaaatgggtgaagtctgtaaaagatttgatggaggctgttgacacttggatc
gagcttcctgagagggacgttgacaaagatttcttgatgcccatcgaagatgtgttcacc
attaccggacgtggtactgtagccacgggccgtatcgaaactggtgttgccaagaccggc
gaccctgttgagatcattggtatgggtgcagagaaattgacctctaccattactggtgtt
gagatgttccgtaaaatcttggatcgtggagaggctggtgacaacgtaggtatcttgttg
agaggtatcgaaaagaccgacatcaaaagaggtatggtgatctgcaagccaggttccgtg
actccgcatgccaagttcaaggctgaggtctatattcttaagaaagaagaaggtggccgt
cacacgccattccacaacaactaccgtccacagttctacgtgcgtacaactgacgtgaca
ggaaacatcaaccttcctgacggtgttgaaatggtaatgcctggcgataacttgaccatt
accgttgacttgatccagcctatcgcattgaacgtaggccttagattcgccatccgtgaa
ggtggtagaaccgtaggtgccggtcaggtaactgagattttagattaa

DBGET integrated database retrieval system