KEGG   Micrococcus luteus: Mlut_00760Help
Entry
Mlut_00760        CDS       T00918                                 

Definition
(GenBank) probable pknA serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mlu  Micrococcus luteus
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mlu01001]
    Mlut_00760
Enzymes [BR:mlu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Mlut_00760
Protein kinases [BR:mlu01001]
 Serine/threonine kinases: Other
  Bacterial family
   Mlut_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Haspin_kinase Kinase-like Kdo Pkinase_fungal Seadorna_VP7 Pentapeptide
Motif
Other DBs
NCBI-ProteinID: ACS29642
UniProt: C5C840
LinkDB All DBs
Position
complement(79492..81606)
Genome map
AA seq 704 aa AA seqDB search
MRPTSGITLGGRYQLTDRIAIGGMGEVWKARDKVLGRITAVKILKEEYTGDPNFLRRFRA
EAQHTALLNHPGVANVYDYGEEKGSAYLVMELVPGQPLSSILEKEKVLSPERTLRIIAQT
AAALSAAHAQGLVHRDVKPGNLMITPTGRVKVTDFGIARLADQVPLTATGQVMGTAQYLA
PEQATGQQATGSSDLYSLGIIGYEALAGHRPFTGESQIAIALAQVNDTPPPLPDTVPAPV
RALIMCMLSKDPKERPSDATALSDAADALRRKDTRGAVEAVPGLAVFLEEQGVADPSGAE
TAPLDYDGMRTTHPRAEGTRADGFPATAALPVTAAQPRTDDDARGPGAAGAAAVGAAGAA
GAAASARTRDHEIAAVRDQQTRPGDVVDPGPPAGGGSAPARRRRANPWPLWALLGLVVFA
LLGALLWPLLTGGRGDGGSAPATSQEESSVHVDPEAYKGRPVSEVRTELEGLGLAVREED
RDAQSPQGTVEEINPVGALQRGETVTLAVSTGEGVIPEGLVGQPVDSAIQTLRDRGFTVD
RVDDPSADGADGEVVRVVPGEGERHRYDTHVQLIVATGGSDAAPTREASQPASEPEPSAS
EEPSSEPSPSASDEPSPSPTAESPTATADPEPMPEPTEEPTTPTGDPTTESSGESTAPTG
QPTTDPSADARGADASSADARGADASSADARGAEASSADATPSA
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgacatcgggcatcaccctcggcggcaggtaccagctgaccgatcgcatcgcg
atcggcggcatgggcgaggtgtggaaggcgcgggacaaggtcctgggccggatcaccgcc
gtgaagatcctcaaggaggagtacacaggtgaccccaacttcctgcgccgcttccgggcg
gaggcccagcacaccgcgctgctgaaccaccccggcgtcgccaacgtctacgactacggc
gaggagaagggctccgcctacctcgtcatggagctcgtgccgggccagccgctgtcctcc
atcctcgagaaggagaaggtgctctcccccgagcggaccctgcggatcatcgcgcagacg
gcggccgcgctctcggctgcccacgcccaggggctcgtgcaccgcgacgtcaagcccggc
aacctcatgatcacgcccaccggccgggtgaaggtgacggacttcggcatcgcgcgcctg
gcggaccaggtcccgctcacggccaccggccaggtgatgggcaccgcccagtacctcgcg
cccgagcaggccacggggcagcaggccaccggctcctccgacctctactcgctgggcatc
atcggctacgaggccctcgccgggcatcgcccgttcacgggcgagtcccagatcgcgatc
gcgctcgcccaggtcaacgacaccccgccgcccctgccggacaccgtcccggccccggtg
cgcgccctgatcatgtgcatgctctcgaaggaccccaaggagcggccgtcggacgcgacc
gcgctctcggacgccgccgacgcgctgcgccgcaaggacacccgcggcgctgtggaggcc
gtgcccggcctggccgtcttcctcgaggagcagggcgtggccgacccctcgggcgccgag
accgctcccctggactacgacggcatgcgcaccacccatccccgcgccgagggcacccgg
gcggacggcttccccgccaccgcggcgctgccggtgaccgcggcccagccccgcaccgac
gacgacgcccgcggccccggcgccgccggtgcggcggccgtgggcgcagccggtgcggcc
ggcgccgccgcgagcgcgcgcacgcgcgaccacgagatcgccgccgtgcgcgaccagcag
acccgcccgggggacgtcgtggacccgggcccgcccgccgggggcggctccgcgcccgcc
cgccggcgacgcgccaacccctggccgctgtgggcgctgctcgggctcgtggtgttcgcc
ctgctgggggcgctgctgtggccgctgctcacgggtggccgcggcgacggcggctcggcg
ccggcgacctcgcaggaggagtcgtccgtgcacgtggacccggaggcgtacaagggtcgc
cccgtgagcgaggtgcgcaccgagctcgagggactcggcctggcggtgcgtgaggaggac
cgcgacgcgcagagcccgcagggcaccgtcgaggagatcaaccccgtgggggcgctgcag
cgcggtgagaccgtcacgctggccgtctccaccggggagggcgtcatcccggagggtctc
gtgggccagcccgtggacagcgcgatccagacgctgcgcgaccgcggcttcaccgtggac
cgggtggacgacccgtccgccgacggcgccgacggcgaggtggtgcgcgtggtgcccggc
gagggcgagcgtcaccgctatgacacgcacgtgcagctgatcgtggccaccggcgggtcc
gacgccgcgccgacccgcgaggcctcccagcccgcctcggagccggagcccagcgcgtcg
gaggagccgagcagcgagccgagcccgtcggcctcggacgagcccagcccgtcccccacc
gccgaatccccgacggccaccgccgacccggagcccatgccggagccgaccgaggagccg
acgacgcccacgggggatccgacgacggagtcctccggggagtccacggcgccgacgggc
cagcccaccaccgacccgtccgccgacgcgcgcggcgcggatgcctcctccgccgacgcg
cgtggcgcggatgcctcctccgccgacgcgcgtggcgcggaggcctcctccgccgacgcc
acgccctccgcctga

DBGET integrated database retrieval system