KEGG   Micrococcus luteus: Mlut_10360Help
Entry
Mlut_10360        CDS       T00918                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mlu  Micrococcus luteus
Pathway
mlu00250  Alanine, aspartate and glutamate metabolism
mlu00280  Valine, leucine and isoleucine degradation
mlu00310  Lysine degradation
mlu00410  beta-Alanine metabolism
mlu00640  Propanoate metabolism
mlu00650  Butanoate metabolism
mlu01100  Metabolic pathways
mlu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mlut_10360
   00650 Butanoate metabolism
    Mlut_10360
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mlut_10360
   00280 Valine, leucine and isoleucine degradation
    Mlut_10360
   00310 Lysine degradation
    Mlut_10360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mlut_10360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlu01007]
    Mlut_10360
Enzymes [BR:mlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Mlut_10360
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     Mlut_10360
    2.6.1.48  5-aminovalerate transaminase
     Mlut_10360
Amino acid related enzymes [BR:mlu01007]
 Aminotransferase (transaminase)
  Class III
   Mlut_10360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 CW_binding_2
Motif
Other DBs
NCBI-ProteinID: ACS30548
UniProt: C5CB15
LinkDB All DBs
Position
complement(1116406..1117728)
Genome map
AA seq 440 aa AA seqDB search
MTATPDLEQTRHLATELPGPRSRELAERQQRAVPAGVATTMPVYAARAAGGILEDVDGNR
LIDLASGIAVTSVGASHPRVVAAVQEQVAQFTHTSFMITPYEGYVAVAEQLDRTSPIPGE
TRTALFNSGAEAVENAVKVARAYTGKQAVAAFDHAYHGRTTLTMALTAKSMPYKHSFGPF
APEIYRVPGSYPLRDGLSGAEAAQRAISALEKQIGADDLAAVIMEPIQGEGGFIVPAEGF
LPAMVEWCKANDVLFIADEVQSGIARTGAWFASETEGIEPDLMATAKGIAGGMPLSGVTG
RAEVMDSVHPGGLGGTYGGNPVATAAALAVFEAVEEDGLLEKARRIEQVIREHFEQNADD
RIAEVRGRGAMMAIEFVDPATGEPDATLTATVAAAVRATGVILLTCGTYGNVVRFLPPLT
IGEDLLKEGLSEVTKALQSA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccacccccgacctcgagcagacccgccacctggccaccgagctgcccggcccc
cgctcccgtgagctcgccgagcgccagcagcgcgccgtcccggccggcgtggccaccacc
atgccggtgtacgcggcccgcgccgcgggcggcatcctcgaggacgtggacggcaaccgc
ctgattgacctggcctccggcatcgccgtcacctccgtgggcgcctcccacccgcgcgtc
gtggccgccgtccaggagcaggtcgcccagttcacccacacctcgttcatgatcacgccc
tacgagggctacgtggccgtggccgagcagctggaccgcaccagcccgatccccggcgag
acccgcaccgccctgttcaactccggcgccgaggccgtggagaacgccgtcaaggtggcc
cgcgcctacaccggcaagcaggccgtggccgcgttcgaccacgcctaccacggccgcacc
accctgacgatggcgctgaccgccaagtccatgccctacaagcacagcttcggaccgttc
gcccccgagatctaccgcgtgcccggctcctacccgctgcgggacggcctgtccggcgcc
gaggccgcgcagcgtgccatctccgcgctggagaagcagatcggtgccgacgacctggcc
gccgtgatcatggagccgatccagggcgagggcggcttcatcgtcccggccgagggcttc
ctgccggccatggtcgagtggtgcaaggccaacgacgtcctgttcatcgcggacgaggtc
cagtccggcatcgcccgcaccggcgcctggttcgcctccgagaccgagggcatcgagccg
gacctgatggcgaccgccaagggcatcgccggcggcatgccgctctccggcgtcaccggc
cgcgccgaggtgatggactccgtgcacccgggcggcctcgggggcacctacggcggcaac
cccgtcgccacggcggcggcgctcgccgtgttcgaggccgtcgaggaggacggtctcctg
gagaaggcccgccggatcgagcaggtcatccgcgagcacttcgagcagaacgccgacgac
cgcatcgccgaggtccgcggccgcggcgcgatgatggcgatcgagttcgtggaccccgcc
accggcgagccggacgcgacgctgaccgccaccgtggccgcggccgtgcgcgccaccggc
gtcatcctgctcacgtgcggcacctacggcaacgtcgtgcgcttcctgccgccgctgacc
atcggtgaggacctcctcaaggagggcctgagcgaggtcacgaaggcgctgcagtccgcc
tga

DBGET integrated database retrieval system