KEGG   Micrococcus luteus: Mlut_16360Help
Entry
Mlut_16360        CDS       T00918                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mlu  Micrococcus luteus
Pathway
mlu00220  Arginine biosynthesis
mlu00250  Alanine, aspartate and glutamate metabolism
mlu00290  Valine, leucine and isoleucine biosynthesis
mlu01100  Metabolic pathways
mlu01110  Biosynthesis of secondary metabolites
mlu01130  Biosynthesis of antibiotics
mlu01210  2-Oxocarboxylic acid metabolism
mlu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mlu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mlut_16360
   00290 Valine, leucine and isoleucine biosynthesis
    Mlut_16360
   00220 Arginine biosynthesis
    Mlut_16360
Enzymes [BR:mlu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Mlut_16360
    2.6.1.66  valine---pyruvate transaminase
     Mlut_16360
Amino acid related enzymes [BR:mlu01007]
 Aminotransferase (transaminase)
  Class I
   Mlut_16360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ACS31124
UniProt: C5CBY3
LinkDB All DBs
Position
complement(1784013..1785251)
Genome map
AA seq 412 aa AA seqDB search
MPTPHPRQIRQSAKLLNVRYDVRGPILEEAQRMEAEGHRIMKLNIGNPAPFGFEAPDAVL
AAMHQHLPHAQGYSDSKGIYSARTAVSQYYESRGIRDIGVDDVFIGNGVSEMITMVLQAL
VDDGDEILVPSPDYPLWTGATTLAGGRAVHYRCVEEEGWEPDLEHIESLITERTKGIVLI
NPNNPTGAVYSRAVLQGIVDVARRHNLVLMADEIYEKITYDGARHINAAGLSDDVLTLTF
SGLSKAYRVAGYRSGWVAVSGPKHRAADFLEGLTLLANMRMCANVPAQHAIQVALGGYQS
INDLVLPGGRLLEQRNLAQDRLNAIPGVSVQPAHGALYLFPRLDPEVYAIDDDEAFVIEL
LRAKKILVSHGGAFNYPHSDHFRLVTLPSVKDLDVALDRLEDFLEDWRERHG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccccgcatccccgccagatccgccagtccgccaagctgctgaacgtccgctac
gacgtgcgcggccccatcctggaggaggcgcagcggatggaggccgagggccaccggatc
atgaagctgaacatcggcaacccggccccgttcggcttcgaggcgccggacgccgtcctg
gcggcgatgcaccagcacctgccgcacgcgcagggctactcggactccaagggcatctac
tcggcgcgcaccgccgtctcgcagtactacgagtcccggggcatccgggacatcggcgtg
gacgacgtgttcatcggcaacggcgtgtccgagatgatcaccatggtcttgcaggccctg
gtcgacgacggcgacgagatcctcgtcccctcgcccgactacccgctgtggaccggcgcc
accaccctggccgggggccgggcggtgcactaccgctgcgtcgaggaggagggctgggag
cccgacctcgagcacatcgagtccctcatcacggagcgcaccaagggcatcgtcctgatc
aacccgaacaaccccaccggcgcggtctactcccgcgccgtgctgcagggcatcgtggac
gtggcccgccgccacaacctcgtcctcatggcggacgagatctacgagaagatcacctac
gacggcgcccgccacatcaacgccgccggcctgtccgacgacgtgctcaccctgacgttc
tcaggcctgtccaaggcgtaccgggtggcgggctaccgctccggctgggtggccgtgtcc
gggccgaagcaccgggccgccgacttcctcgagggcctgaccctgctggccaacatgcgg
atgtgcgccaacgtgcccgcgcagcacgccatccaggtggcactgggcggctaccagtcc
atcaacgacctcgtcctgcccggcggccggctgctcgagcagcgcaacctcgcccaggac
cgcctgaacgccatccccggcgtgtccgtgcagccggcccacggcgccctctacctgttc
ccgcggctggacccggaggtctacgcgatcgacgacgacgaggcgttcgtcatcgagctg
ctgcgggcgaagaagatcctcgtctcgcacggcggggcgttcaactacccgcacagcgac
cacttccggctcgtcacgctgcccagcgtgaaggacctggacgtggccctggaccgcctc
gaggacttcctcgaggactggagggagcgccatggctga

DBGET integrated database retrieval system