KEGG   Methanosarcina mazei Go1: MM_0209Help
Entry
MM_0209           CDS       T00082                                 

Definition
(GenBank) hypothetical protein
Organism
mma  Methanosarcina mazei Go1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N
Motif
Other DBs
NCBI-ProteinID: AAM29905
UniProt: Q8Q0C8
LinkDB All DBs
Position
complement(284316..284774)
Genome map
AA seq 152 aa AA seqDB search
MLEEYEKKRDFNKTSEPPARGEEKNSDKPVFVVQRHDATNLHYDFRLEMDGVLKSWAVPK
EPPKSPGTRRLAIETEDHPLGYADFEGEIPEGQYGAGRVEIWDRGTFELLKRNEKEIIIT
LHGEELEGDYVLIKTKYGKEDKGWLFFKKKTG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagaatatgagaagaaaagggattttaataagacctccgaaccccctgccaga
ggggaagagaagaattccgataagcctgtttttgtggttcagcgccatgatgcgaccaat
ctccattatgattttcgcctggaaatggacggagtccttaagagctgggcagttcctaaa
gagcctccgaaaagcccgggaaccaggaggctcgctatcgagactgaagaccatccactc
ggatatgcagactttgaaggggaaattccagaaggacagtacggagccggcagagttgag
atctgggacaggggtacttttgaacttctaaaacgcaacgagaaagagattattataacg
cttcacggggaagaacttgaaggagattacgtactgataaaaacaaagtacggaaaagag
gataaagggtggctattttttaagaaaaaaaccggttaa

DBGET integrated database retrieval system