KEGG   Methanosarcina mazei Go1: MM_1307Help
Entry
MM_1307           CDS       T00082                                 

Definition
(GenBank) conserved protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mma  Methanosarcina mazei Go1
Brite
KEGG Orthology (KO) [BR:mma00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MM_1307
Enzymes [BR:mma01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MM_1307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNA_ligase DNA_ligase_A_M TusA
Motif
Other DBs
NCBI-ProteinID: AAM31003
UniProt: Q8PXB5
LinkDB All DBs
Position
1555307..1556476
Genome map
AA seq 389 aa AA seqDB search
MKRGDEEIDSGFVERLAGFLGFDEERVQHLFEKIYLARNWGKHDYLFRFDKEISRIERGT
VLYEKGDSFEVIMGFPKIRRAMVLDPTLKKHFSGLEKITVEEKMNGYNVRVAKVKDDILA
ITRSGYICPYTTEKAKEKLDLKFFDDFPELVLYGEMLGPDNPYVPKEIYGIDSVEFYIFD
IREKNTGNPLPISKKHEILEEYGFLQVECFGEFPLHTAAEQITKIIRELGKKEHEGVVIK
DPDMILAPLKYTSSQSNCSDLRHAFRFYNEAGRDYMLPRIVREGFQTVEWDENEAEFKKR
YMQLGESILRPLRESIQSVKNGQRLYEEVRIRVKDPKTATEFENYLKRLGVDAIFEEPQP
IGNEYLINIKKINKSTNDKTQAIWEGELW
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaggggatgaggaaatagattctggctttgttgagcggctggctggatttctg
ggatttgatgaagaaagagttcaacacctttttgaaaaaatctatcttgcgagaaattgg
gggaaacatgactatttattccgttttgacaaggagatttctcgcatagaaagaggtacg
gtactttacgaaaagggagactcgtttgaagtaattatgggttttcccaaaatccggaga
gctatggtactggaccccactctaaagaaacatttcagcgggcttgagaagataactgta
gaagaaaagatgaacgggtataatgtcagggttgcaaaagtaaaagacgatatcctggca
attaccagaagcggctatatttgcccctatactactgaaaaggcaaaagagaagcttgac
ctgaagttttttgatgacttccccgaacttgtgctttatggagaaatgctgggccctgac
aacccctatgtcccaaaagagatctacggcattgactccgtggagttctatatcttcgat
attcgggaaaaaaatactggaaaccctcttccaataagcaagaaacacgaaattctggaa
gaatatggttttttgcaggttgaatgttttggagaatttccccttcatacagctgcagaa
caaattactaaaataatccgggaactcgggaaaaaagaacacgaaggagtggtaataaaa
gatcctgatatgattcttgctcccctgaaatacacctcatcccagagcaactgttctgac
ctcaggcacgccttcaggttctataatgaagcaggcagggactatatgctccccaggatt
gttagagaggggttccagacggttgaatgggacgaaaatgaagccgaattcaaaaagcgt
tatatgcagctgggggaaagtatcctgagacccctgagagagtctatccaaagtgtaaag
aacggacagaggctctatgaagaagtcagaatccgtgtaaaggacccgaaaactgcaaca
gaattcgagaattacctcaaaaggcttggagtggatgctatctttgaagaaccacagcct
ataggaaatgaatacctgataaacatcaaaaaaatcaataaaagcaccaatgataaaact
caggcgatctgggaaggagaactctggtaa

DBGET integrated database retrieval system