KEGG   Methanosarcina mazei Go1: MM_1442
Entry
MM_1442           CDS       T00082                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mma  Methanosarcina mazei Go1
Pathway
mma00300  Lysine biosynthesis
mma01100  Metabolic pathways
mma01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mma00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MM_1442
Enzymes [BR:mma01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MM_1442
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AAM31138
UniProt: Q8PWY4
LinkDB
Position
complement(1724409..1725203)
AA seq 264 aa
MALLTPEDLENINKQLQEADSTVRRVTGLDIKGICKDFYGTTPCCEKVGIVPVTSGNGII
GSFSESLNAIAGYFGFDSFITDMPDVSGYYEAVKNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKEVLAVGLGKVGFPGAAHLVQKGFKVYGYDADRTLLEKS
VSSLGIIPFNPVSPEGDRQRKFSIIFEATPCADTIPESVISENCVISTPGIPCAISKELQ
KKCGVELVMEPLGIGTASMLYSVL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctggaaaatattaacaaacagcttcaagaagctgat
tctactgtccgcagagttacagggcttgatataaaaggtatctgtaaagatttctacggc
acaactccatgctgtgaaaaagtaggtatcgtgcctgtgacctcagggaacgggatcata
gggagcttttccgaatccctgaatgcaattgccgggtatttcgggtttgacagttttatt
actgatatgcctgacgtcagcggatattatgaggcagtaaagaacggagcccggatcata
cttatggcagatgataataccttccttgcccacaacctgaaaaatggaaaaatcgccaat
aaccagccgtgtacaggcataatttatgctgaaatagcttcaagatacctgaaagccgat
tccaaagaagtgcttgccgtgggtcttgggaaggttggatttccgggagcagcccatctc
gtacagaaaggcttcaaggtttacggatatgatgctgacagaacccttctagaaaaaagc
gtttccagcctcggaattatacctttcaatcccgtcagccccgaaggcgacaggcaaagg
aagttttccattattttcgaagcaaccccctgtgcagacacgattccggaatccgtaatt
tcggaaaactgtgtgatttctacccctgggataccctgtgcaatctcaaaggagctgcaa
aaaaagtgtggagttgaacttgtaatggaaccactggggataggtacagcatcaatgctg
tattctgtactctaa

DBGET integrated database retrieval system