KEGG   Moritella marina: FR932_02150Help
Entry
FR932_02150       CDS       T06214                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mmaa  Moritella marina
Brite
KEGG Orthology (KO) [BR:mmaa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FR932_02150 (ahpF)
Enzymes [BR:mmaa01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     FR932_02150 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Thioredoxin_3 Pyr_redox FAD_binding_2 GIDA HI0933_like DAO FAD_oxidored AlaDh_PNT_C FAD_binding_3 Thi4 Glutaredoxin Thioredoxin_9 NAD_binding_8 NAD_binding_7 K_oxygenase NAD_binding_9 DUF4404 Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: QFI36715
UniProt: A0A5J6WIU2
LinkDB All DBs
Position
complement(439061..440650)
Genome map
AA seq 529 aa AA seqDB search
MLDQNMKTQLKAYLQNLKTEVQLVLSLDDSQTAQKLHTLANDIASLSEKVIVIEDQSASA
RKPIMQVVNPMKQTAIGFAGLPMGHEFTSLVLALLHSGGHPMKLDAEVIEQIANLEGEMN
FEIFISLSCQNCPDVVQALNMMAATNPNIKTTMIDGAAFQDEVAERNIMAVPSVYLNGEV
FTQGRISLTEILAKVDTGAAKKQALALNEKAPYEVLVVGGGPAGASAAIYAARKGIRTGV
VAERFGGQVMDTMAIENFISVKETQGPKLAAALEEHVKEYHVDIMNEQRAAGVVSAEKTA
DGYIHVELDSGAILKSRSVILSTGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKVA
VIGGGNSGIEAAIDLAGLVEHVTVLEFADTLRADQVLVNKADSIANITIIKQAQTTEVIG
DGTRVTALNYVDRATGDAKQLELAGIFVQIGLMPNSDFLKGSDVELSARGEIEVNAKGET
SVAGIFAAGDVTTVPYKQIIIAMGEGSKASLSAFDHLIRTPAPTDTVNA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgttagaccaaaatatgaaaacccagttaaaggcgtatttacaaaacttaaagaccgaa
gtacagctagtactaagccttgatgacagccagaccgcacagaaattacataccctagct
aatgacatcgcatcattaagcgaaaaagtaattgttatcgaagatcaaagcgcgagcgca
cgtaaacctatcatgcaggtagttaatccgatgaagcaaactgccattggctttgctggt
ttaccaatgggacatgaatttacatctttggtgttagccctactacatagtggtggccat
ccaatgaaactcgatgccgaagtcattgaacaaattgctaatcttgaaggtgaaatgaat
tttgaaatattcatatcattaagctgtcaaaactgcccagatgttgtgcaagccttaaat
atgatggctgcaacgaatcctaatattaaaacaaccatgattgacggcgcagcattccaa
gatgaagtagctgaacgtaacatcatggccgtaccaagtgtttacttaaatggtgaagtg
ttcacccaaggtcgtatttcattaacagaaatattagctaaagttgatactggcgcagca
aaaaaacaagcgctagcattaaacgaaaaagcaccgtacgaagtactcgttgttggtggt
ggtccagctggcgcatctgctgctatctacgctgcacgtaaaggtatccgtaccggtgtc
gttgctgaacgctttggtggtcaagttatggataccatggcaattgaaaactttatttca
gtcaaagaaactcaaggtcctaaactcgcagctgcacttgaagagcacgttaaagaatat
catgtggatatcatgaatgagcaacgagccgcaggtgtagtgagtgctgaaaaaacagct
gatggctatattcatgttgaactcgatagtggcgcgatattaaaaagccgcagtgtgatc
ttatcaacaggtgcacgttggagagaaatgaatgtacctggcgaacaagaataccgcaac
aaaggcgtggcttattgcccacattgtgatggtccattgtttaaaggcaaaaaagtggct
gttattggtggcggtaattccggtatcgaagcggctatcgacttagcgggcttggttgaa
catgtgaccgtgcttgaatttgcagataccttacgtgccgatcaagtattggttaataag
gccgacagtattgctaacattaccattattaaacaagcgcaaaccactgaagtaattggt
gatggtacacgtgtaacagcgcttaattatgttgaccgcgccactggcgatgcgaaacaa
cttgaacttgccggtatctttgtacaaattgggttgatgccaaacagtgatttcttaaaa
ggcagtgatgtggagttatcagcccgtggcgaaattgaagtgaatgctaaaggcgaaact
tcggttgcaggtatatttgccgctggtgatgtaacaacagtaccttataagcaaatcatc
attgccatgggtgaaggttcaaaagctagcttaagtgcctttgaccatttgattcgtact
ccggcaccaactgataccgttaacgcttaa

DBGET integrated database retrieval system