KEGG   Methanosarcina mazei C16: MSMAC_0063Help
Entry
MSMAC_0063        CDS       T04626                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mmac  Methanosarcina mazei C16
Pathway
mmac00630  Glyoxylate and dicarboxylate metabolism
mmac01100  Metabolic pathways
mmac01120  Microbial metabolism in diverse environments
mmac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mmac00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSMAC_0063
Enzymes [BR:mmac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSMAC_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB69953
UniProt: A0A0E3RW05
LinkDB All DBs
Position
79003..80289
Genome map
AA seq 428 aa AA seqDB search
MRRDYIDIGYSPKETDLVCEFHIEPTAGVNFEEAATHLAGESSIDSWTEIATLSPELAEK
LKPHVFYADEGAQTIRVAYSEELFELGSVPQVLSAVAGNILSMKIVDNVRLQDIAFPKSM
INEFKGPNFGLPGIRKLVGVQDRPLIGTIVKPKVGLNSEKHAEVAYNSFVGGCDLVKDDE
NLSDQKFNSFEKRAELTLKLAEKAESETGEKKMYLCNVTAPTCREMIRRMNFLKDLGASY
VMVDIVPAGWTAIQTLREEAEDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLIGLD
QLHIGTVVGKMHGEKHEVLNLRDQCVLDKVPADESQHILAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTVAGATACRQALEASLEGISLQDYAKNHKELET
ALGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagaagggactatattgacatcggctacagcccgaaagagacggatctggtctgtgaa
ttccacattgaaccaacagcaggagtgaattttgaagaagctgccacccatctggcaggg
gaaagttccatagattcctggactgagattgctacgctgagtcctgaacttgcagagaaa
ctgaaaccccatgtcttttatgcggatgagggtgcacagactataagggttgcttattcg
gaagagctttttgagctgggttctgtccctcaggtcctcagtgctgttgcagggaatatc
ctgagcatgaaaatagttgataacgtaaggctgcaggatatcgctttcccgaaatcaatg
attaatgaattcaaaggccctaacttcggactgccggggatcagaaaacttgtgggcgta
caggacaggcctctcatagggactattgttaaaccgaaagtcggcctgaactctgaaaag
cacgctgaggtcgcttacaattcttttgtcgggggctgcgaccttgttaaggacgatgaa
aatctgagtgatcagaaatttaacagttttgagaagagagccgagcttaccctgaaactt
gcagaaaaggcagagtctgagacaggggaaaagaagatgtacctctgcaatgtcactgcc
cccacctgcagggaaatgatccgccgcatgaacttccttaaagaccttggagccagttat
gtaatggttgacatcgtgcccgctggctggactgcgattcaaaccctgcgcgaggaagct
gaggatgcgggtcttgcccttcacgcccaccgctgcatgcattccgcctacacacgaaac
ccgcgccatgggataagcatgcttgttgttgccaagctgtgcaggctgataggccttgac
cagctccacataggcactgttgtcgggaaaatgcatggagaaaagcatgaagtccttaac
ctcagggaccagtgcgtgctcgataaagtgcctgccgacgaaagccagcatatccttgcc
caggactgggggggattaaagccaatgttccctgtagcatccggaggtctcgctcctaca
atgatccctgacctttattctatctttggaaaagacgttattatgcagttcggaggcgga
attcacgctcacccaatgggcacagtagccggagccactgcgtgcaggcaggctctcgaa
gcaagccttgaaggaatcagcctccaggactatgcgaaaaatcataaagaacttgaaacc
gctcttggaaaatggttgaagaaataa

DBGET integrated database retrieval system