KEGG   Methanosarcina mazei C16: MSMAC_0392Help
Entry
MSMAC_0392        CDS       T04626                                 

Definition
(GenBank) Kef-type transport system 2 (probable substrate potassium), subunit 2
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
mmac  Methanosarcina mazei C16
Brite
KEGG Orthology (KO) [BR:mmac00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    MSMAC_0392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_N TrkA_C AlaDh_PNT_C 3HCDH_N DUF4147
Motif
Other DBs
NCBI-ProteinID: AKB70282
UniProt: A0A0E3RVN3
LinkDB All DBs
Position
490019..491875
Genome map
AA seq 618 aa AA seqDB search
MGLVQDLGNIEMLAEIGVILLLFTIGMEFSLRELLQLRRIVIFGGGLQLFITTLAAAFIF
LILGISRETAIFLGLLVALSSTAIVLKILQEKGEIYSLHGRTSLGILIFQDVAAVMIILL
IPLLAGTQGTEKSFVELILQGFGLILFTIFSARYAVPFIMFQVAKTRNSELFLLSVVAIG
LAVAWLTSMVGLSLALGAFLAGLIISESEYSIQALGNLIPFRDMFMSIFFISMGMLLDLG
VLREHLPLILAATLGVLILKAAANSLSTFLIGFPLHTMILVGFSLSQVGEFSLILAKVGF
TSGLIITEIYQEFLDIAVISMVLTPFIMSMGYRTTSFAESLPLPSIVKTGWYRHFKEHVP
QDAPENHVIVIGFGINGRNVAAAAKSSSIPYRIIEINPETVRQEKQKGEHILYGDAAQKA
VLEHAGIRTAKSVVVTAGDPVSARRVIEAARRLNPEVHIIARTHFLSELDKFHIAGADEV
ISDEFESSIEIFTRVLHRYLVPSSEIDSLGSTLRSDHYRMLRSPDIPRKKFCDLALDFAD
VEIRSIRVGELSRAAGMTIGDLNVRKKYGVSILAISRNHKLISEMQAETEIHSNDILLVI
SPPEKLDEVKKLFEDPVR
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
ttgggcttggtccaagatctgggcaatattgaaatgctggctgagataggagtcatattg
ctgctctttactatcgggatggaattttccctgcgtgaactcctgcagcttcgcagaata
gtcatctttggaggagggttgcagctttttataactactcttgctgccgcttttattttc
ctcattcttggaatttccagagaaactgcaattttcctcggactcctggtggcattgagc
agtacggcaatagtccttaaaatcttgcaggaaaaaggggaaatttacagtcttcacggg
cggacttccctggggatattgatcttccaggacgtagctgcagtaatgataattctcctg
attcctctccttgcgggaactcagggaacggaaaaatctttcgtagaacttatcctgcag
ggatttgggcttatactgtttactatattcagcgccagatatgcagtcccttttattatg
ttccaggtagcaaagacgcgtaatagcgaactgtttctcctgagtgttgtggcaatcgga
ctcgcggttgcctggctgacttccatggtcggtctttctctggctcttggagcttttctt
gccggtctgatcatctcagagtccgaatattcgatccaggctcttgggaacttaattcct
ttcagggatatgttcatgagcatttttttcatttcaatggggatgcttcttgatctgggt
gtattaagagaacatttacccttaatactggctgcaactcttggagtgctgattttgaaa
gctgcagcaaattcccttagcactttccttataggttttcctttgcataccatgatcctg
gtcggtttctccctctctcaggttggggaattttccctgattcttgcgaaggtaggcttt
acgagcgggctgataattactgaaatttatcaggagtttctagatattgctgtaatttcc
atggtactcactcctttcataatgagcatgggatatcggactacatcatttgccgagtct
ctccccttaccttcaatagtaaaaaccgggtggtacaggcattttaaggagcacgtacct
caagatgcgcctgaaaaccatgtgattgtgataggtttcggaataaatgggagaaatgtc
gcagcggctgcaaagtcatcttctatcccctaccggataatcgagatcaatcccgaaacc
gtcaggcaggagaaacagaaaggagaacatatcctttatggagacgctgcccagaaagcc
gttctggaacatgcaggtatccggactgcgaaatcggttgttgtgaccgcaggggatccg
gtaagtgccagaagagttattgaagctgccaggcggctaaaccctgaagtccatattatt
gccaggacacatttcctgagcgagctggataaatttcatatcgccggagccgatgaagtt
atttcggatgagtttgaaagctcaatagaaattttcacaagagtgctccacaggtatctg
gttccttcaagtgaaatcgattctctgggctcaaccttacgctccgaccattacaggatg
cttcgcagtcctgacattccccggaaaaagttctgcgacctggctctcgattttgcagat
gtggaaataaggagtatcagggttggggaactttccagggcggcaggaatgaccattgga
gatctcaacgtcaggaaaaaatatggagtctctatacttgcaatttccagaaatcataaa
cttatctccgagatgcaggcagagaccgaaatccattcaaacgacatcctgcttgtgatt
agccctcctgaaaagcttgatgaagttaaaaagctttttgaagatccggtgagataa

DBGET integrated database retrieval system