KEGG   Methanosarcina mazei C16: MSMAC_1508Help
Entry
MSMAC_1508        CDS       T04626                                 

Definition
(GenBank) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
mmac  Methanosarcina mazei C16
Pathway
mmac00260  Glycine, serine and threonine metabolism
mmac00270  Cysteine and methionine metabolism
mmac00680  Methane metabolism
mmac01100  Metabolic pathways
mmac01120  Microbial metabolism in diverse environments
mmac01130  Biosynthesis of antibiotics
mmac01200  Carbon metabolism
mmac01230  Biosynthesis of amino acids
Module
mmac_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mmac00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    MSMAC_1508
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMAC_1508
   00270 Cysteine and methionine metabolism
    MSMAC_1508
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmac04147]
    MSMAC_1508
Enzymes [BR:mmac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     MSMAC_1508
    1.1.1.399  2-oxoglutarate reductase
     MSMAC_1508
Exosome [BR:mmac04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMAC_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT IlvN NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AKB71398
UniProt: A0A0E3RZA0
LinkDB All DBs
Position
1849242..1850813
Genome map
AA seq 523 aa AA seqDB search
MKVLVSDSLSNEGLEILKEHFDIDVCTGLCEDELVEKIKGYDALVIRSGTQVTQRIIEAA
DNLKIIGRAGVGVDNVDVDAATKKGIIVANAPEGNMISAAEHTIAMMMSMSRNIPQANAS
LKAREWKRNKFMGVEVKGKTLGVIGLGRIGSEVAKRAAGLEMNLMGYDPFISEKRAMELG
VKLATVNEIAKEADYITVHTPLIKETRNILDDEQFALMKKGVRVLNCARGGIINEEALAR
ALESGKVGGAAIDVFVEEPPFSSPLLNFDNVIVTPHLGASTQEAQVNVAIDIAKEVVSVL
TGGSAKNAINIPSVKPEAMAVLAPYIRLSELMGKIAGQLVDSNYEKVEIAYNGEISGKDT
RPLTVSALKGLLEMAVGSGVNYVNAPILAKSRKIAVVESKSESAEEYSSTVSIRLSSGES
TKMVAGTVVGDEPKIVSIDDDKVDIFPAGRMIFAKHINKPNVIGPCCMVLGKNNINISGM
QVGRSEVGGVTMMVLNVDTDVSDAILDEVRQVPGILNAKLVTL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtattggtcagcgactcactctccaacgaagggttggagatcctaaaagaacat
tttgatattgatgtctgcaccgggctctgtgaagatgagctggtggaaaagatcaaaggc
tacgacgcccttgtaatacgcagcggtacccaggttactcagagaataatcgaggctgct
gacaacctgaagattatcggaagggcaggggtcggagtcgacaatgtggatgtggatgca
gccacaaagaaaggtatcatcgtggccaacgctcccgaagggaacatgatctcggcagca
gagcacacaattgccatgatgatgtcaatgtcgaggaatatccctcaggccaacgcttcc
ctgaaagccagggaatggaagcgcaataagttcatgggcgttgaggtcaagggaaagacc
ctgggagttataggtctcggaagaattgggtctgaagtcgcaaagagagctgcagggctt
gaaatgaacctcatgggatatgaccccttcatctccgagaagcgggctatggaacttgga
gtcaagctggctacagttaacgaaatcgcaaaagaggctgactacataacagtacatacc
ccacttatcaaggaaaccagaaacattcttgacgacgagcagttcgcccttatgaagaaa
ggagtccgggttcttaactgcgcccgcggaggcattatcaacgaagaagcccttgcaaga
gcccttgaaagcggcaaggtaggcggcgcagccattgacgtttttgtcgaagagcctcct
ttctccagccctcttcttaactttgacaatgttatcgtaactccccacctcggtgcctct
acacaggaagctcaggttaatgttgcaatcgacattgcaaaggaagttgtttccgtcctt
acaggcgggtctgcaaagaacgcaatcaatatcccctccgtaaagcctgaagctatggca
gtccttgccccgtatataaggctttcagaactcatgggcaaaattgcagggcagcttgtg
gacagcaattatgaaaaggtagaaattgcatataacggggaaatctccggaaaagatacc
agaccacttacagtttctgctctcaaagggctgcttgaaatggctgttgggtccggggta
aattatgtcaacgctccaatccttgcgaagtccagaaaaatcgcagtggtagaaagcaag
tctgaatctgcggaagagtattcttccactgtcagtatcaggctctccagcggagaatct
acaaaaatggtcgcaggaaccgttgttggggatgagcccaagatagtttccatcgatgat
gacaaggtagatatcttcccggctggtcgtatgatttttgccaaacatataaacaaaccg
aacgttatcggtccctgttgcatggtccttgggaaaaacaatatcaacatttcaggcatg
caggttggcaggtcggaagtcggaggcgtgaccatgatggttcttaatgtcgacaccgat
gtttccgatgctatccttgatgaggtcaggcaggttccgggcatccttaatgccaagctt
gtaaccctctga

DBGET integrated database retrieval system