KEGG   Methanosarcina mazei C16: MSMAC_3244
Entry
MSMAC_3244        CDS       T04626                                 

Definition
(GenBank) Proline reductase for pyrrolysine biosynthesis
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mmac  Methanosarcina mazei C16
Pathway
mmac00300  Lysine biosynthesis
mmac01100  Metabolic pathways
mmac01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmac00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    MSMAC_3244
Enzymes [BR:mmac01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     MSMAC_3244
SSDB
Motif
Pfam: NAD_binding_2 UDPG_MGDP_dh_N
Other DBs
NCBI-ProteinID: AKB73134
UniProt: A0A0E3RY64
LinkDB
Position
4002676..4003470
AA seq 264 aa
MALLTPEDLENINKQLQEADSTVRRVTGLDIKGICKDFYGTTPCCEKVGIVPVTSGNGII
GSFSESLNAIAGYFGFDSFITDMPDVSGYYEAVKNGARIILMADDNTFLAHNLKNGKIAN
NQPCTGIIYAEIASRYLKADSKEVLAVGLGKVGFPGAAHLVQKGFKVYGYDADRTLLEKS
VSSLGIIPFNPVSPEGDRQRKFSIIFEATPCADTIPESVISENCVISTPGIPCAISKELQ
KKCGVELVMEPLGIGTASMLYSVL
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcacttttaaccccagaagacctggaaaatattaacaaacagcttcaagaagctgat
tctactgtccgcagagttacagggcttgatataaaaggtatctgtaaagatttctacggc
acaaccccatgctgtgaaaaagtaggtatcgtgcctgtgacctcagggaacgggatcata
gggagcttttccgaatccctgaatgcaattgccgggtatttcgggtttgacagttttatt
actgatatgcctgacgtcagcggatattatgaggcagtaaagaacggagcccggatcata
cttatggcagatgataataccttccttgcccacaacctgaaaaatggaaaaatcgccaat
aaccagccgtgtacaggcataatttatgctgaaatagcttcaagatacctgaaagccgat
tccaaagaagtgcttgccgtgggtcttgggaaggttggatttccgggagcagcccatctc
gtacagaaaggcttcaaggtttacggatatgatgctgacagaacccttctagaaaaaagc
gtttccagcctcggaattatacctttcaatcccgtcagccccgaaggcgacaggcaaagg
aagttttccattattttcgaagcaaccccctgtgcagacacgattccggaatccgtaatt
tcggaaaactgtgtgatttctacccctgggataccctgtgcaatctcaaaggagctgcaa
aaaaagtgtggagttgaacttgtaatggaaccactggggataggtacagcatcaatgctg
tattctgtactctaa

DBGET integrated database retrieval system