KEGG   Mycobacterium marinum E11: MMARE11_00160Help
Entry
MMARE11_00160     CDS       T04774                                 

Gene name
pknB
Definition
(GenBank) serine/threonine-protein kinase B PknB
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmae  Mycobacterium marinum E11
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmae01001]
    MMARE11_00160 (pknB)
Enzymes [BR:mmae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MMARE11_00160 (pknB)
Protein kinases [BR:mmae01001]
 Serine/threonine kinases: Other
  Bacterial family
   MMARE11_00160 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PASTA Pkinase Pkinase_Tyr APH Pkinase_fungal Kdo Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: CDM74166
LinkDB All DBs
Position
complement(16687..18567)
Genome map
AA seq 626 aa AA seqDB search
MTTPQHLSDRYELGDILGFGGMSEVHLARDLRLHRDVAVKVLRADLARDPSFYLRFRREA
QNAAALNHPAIVAVYDTGEAETPSGPLPYIVMEYVNGVTLRDIVHTDGPMAPTRAIEIIA
DACQALNFSHQNGIIHRDVKPANIMISTTNAVKVMDFGIARAIADSGNSVTQTAAVIGTA
QYLSPEQARGDSVDARSDVYSLGCVLYEILTGEPPFTGDSPVAVAYQHVREDPIPPSERH
EGISAELDAVVLKALAKNPDNRYQTAAEMRADLVRVHNGEAPEAPKVLTGAERRSLTASS
PSSPAAPRTDPLPRQTLDDTDRDRSTPSVGRWVAVVAVLAVLTIVVTIAINTFGGNTRNV
QVPNVRGQASADAIAALQNRGFKTRTLLKPDSTIPPDHVIGTDPAANASVSAGDQITINV
STGPEQRELPDVSSMTYAEAVKKLTAAGFGRFKEAKSPSTPELMGKVIGTNPPANQTSAI
TNVITIIVGSGPATKQIPDVAGQSVEEAEQNLNVYGFTKFSQASVDSPKPAGSVIATNPP
AGTTVPIDSVIELQVSKGNQFVMPDLSGMFWTDAEPRLRALGWTGSLDKGPDVDAGGSQH
NRVVYQNPPAGAGVNRDGIVTLKFGQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccctcagcacctgtccgaccgctacgaactgggcgacatcctcggtttcgga
ggcatgtcggaggtacacctcgcccgcgacctgcggctacaccgcgacgtcgcggtcaag
gtgctgcgcgctgacctggctcgcgatcccagcttctatctgcgcttccggcgggaggcg
caaaacgccgccgcgctcaatcacccggcgattgtcgcggtgtacgacaccggcgaagcc
gagacgccgtccggaccgttgccctacatcgtcatggagtacgtcaacggggtcaccctg
cgtgacatcgtgcacaccgacggcccgatggcccccacgcgtgccatcgaaatcatcgcg
gacgcgtgccaggcactgaacttcagccatcaaaacggcatcattcaccgcgacgtcaag
ccggcaaacatcatgatcagcaccaccaatgcggtcaaggtgatggacttcggcatcgcg
cgcgcgatcgccgacagcggcaacagcgtcacccagaccgcggcggtcatcggcaccgcg
cagtacctgtcgcccgagcaggcccgcggcgattcggtcgacgcacgatctgacgtctac
tcgttgggatgcgtgctctacgagatcctgaccggcgagccaccgttcaccggcgattcc
ccggtcgcggtcgcctaccagcatgttcgggaagaccccatcccgccgtcggaacgccac
gaagggatctccgccgagctggacgcggtggtgctcaaggccctggccaagaacccggac
aaccgctaccagaccgccgcggagatgcgcgccgacctggtgcgggtgcacaacggcgaa
gcgcccgaggcacccaaagtgctgaccggcgccgagcggcgctccctgacggcgtcctcg
ccgtccagcccggccgccccgcgcaccgacccgctgcctcgccagacactcgatgacacc
gaccgggaccgcagcacgccctcggtcggccgctgggtggccgtggtggccgtgctggcc
gtactgacgatcgtcgtcaccatcgccatcaacacgttcggcggcaacacccgcaacgtg
caagttcccaatgtgcggggccaagcatcggcggatgccatcgctgcgctgcaaaaccgt
ggcttcaagacccgcaccctgctcaagccggactcgacgatcccacccgaccacgtcatc
ggtaccgacccggccgccaacgcctcggtgtcggccggcgaccagatcaccatcaacgtc
tccaccggtcccgagcagcgcgagctccccgacgtctcctcgatgacctacgccgaggcc
gtcaagaagctgaccgcggcgggattcggcaggttcaaagaggccaagtcgccctcgacc
cccgaactgatgggcaaggtcatcggaaccaacccgccggccaaccagacgtcggcgatc
accaacgtcatcacgatcatcgtcggctctggccccgcgaccaagcagattcccgacgtc
gcgggccaaagtgttgaggaagccgaacagaacctcaacgtttacgggttcaccaagttc
agtcaggcatcggtggatagccccaagcctgccggcagcgtcatcgccaccaatccgccg
gcgggcaccacggtgccgatcgattcggtgatcgagctacaggtgtccaagggcaatcag
ttcgtcatgcccgacctgtccggcatgttctggaccgacgccgagccgcggttgcgcgcg
ctgggctggacgggatcactggacaaggggcccgacgtggacgccggcggttcccagcac
aaccgggtcgtgtatcagaatccgcccgccggtgccggggtgaaccgcgacggcattgtc
acgctgaagttcggtcagtag

DBGET integrated database retrieval system