KEGG   Mycobacterium marinum E11: MMARE11_01450Help
Entry
MMARE11_01450     CDS       T04774                                 

Gene name
icd2
Definition
(GenBank) isocitrate dehydrogenase [NADP] Icd2
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00020  Citrate cycle (TCA cycle)
mmae00480  Glutathione metabolism
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01130  Biosynthesis of antibiotics
mmae01200  Carbon metabolism
mmae01210  2-Oxocarboxylic acid metabolism
mmae01230  Biosynthesis of amino acids
Module
mmae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmae_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMARE11_01450 (icd2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MMARE11_01450 (icd2)
Enzymes [BR:mmae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MMARE11_01450 (icd2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: CDM74294
LinkDB All DBs
Position
complement(179233..181470)
Genome map
AA seq 745 aa AA seqDB search
MSAEQPTIIYTLTDEAPLLATYAFLPIVRAFAEPAGIEIKTSDISVAARILAEFPDYLTD
EQRVPDNLAELGELTQDPDTNIIKLPNISASVPQLKAAIKELQDKGYAIPDYPADPKTDE
EKALKERYARCLGSAVNPVLRQGNSDRRAPNAVKEYARKHPHSMGEWSMASRTHVAHMRH
GDFYAGEKSITLDRAHKVKMELVTKGGQTLVLKPEVSLDDGDIIDSMFMSKKALCEFYEE
QIEDAYKTGVMFSLHVKATMMKVSHPIVFGHAVKTFYRDAFAKHQKLFDELGVNVNNGLS
DLYSKIETLPASQHDEIIDDLHRCHEHRPELAMVDSARGITNFHSPSDVIVDASMPAMIR
AGGKMYGADGKLKDTKAVNPESTFSRIYQEIINFCKTNGQFDPTTMGTVPNVGLMAQQAE
EYGSHDKTFEVPEDGVANIVDLDTGEVLLTQDVEAGDIWRMCVVKDAPIRDWVKLAVTRA
RNSGMPVLFWLDPYRPHENELIKKVKTYLKDHHTEGLDIQIMSQVRSMRYTLERLIRGLD
TIAATGNILRDYLTDLFPILELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVKQLVEEN
HLRWDSLGEFLALGASLEDMGIKIGNDRAKILARTLDDAIGKLLGNNKSPSRKTGELDNR
GSQFYLALYWAQELAEQTDDAELAEHFAKLAKALADGEEAIVAELAEAQGEAVDIGGYYA
PDNEKTTAVMRPSKTLNAALEAAQG
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgagcagccgaccatcatctacacgctgaccgacgaggcgccactgctggcg
acctacgctttcctgcccatagtgcgggcttttgccgagcccgctggcattgagatcaag
accagtgacatctcggtggccgcacgcatcctggccgaatttcccgactacctcaccgac
gagcagcgggtcccggacaatctggccgagctgggcgagctgacgcaggacccggacacc
aacatcatcaagctgcccaacatcagcgcatcggtgccccagctcaaggcggcgatcaag
gagctgcaagacaaggggtacgcgattccggactatccggccgacccgaagaccgacgag
gaaaaggcgctcaaggagcgctacgccaggtgcttgggcagtgcggtgaacccggttctg
cgccaaggcaactcggaccgtcgggcgcccaatgcggtcaaagagtacgcccgcaagcac
ccgcacagcatgggtgaatggtcgatggcttcgcgtacccacgtcgcccacatgcgacac
ggcgacttctatgccggtgagaagtcgataacgctggaccgcgcgcacaaggtgaagatg
gaactggtgaccaagggcggccagacgctggtgctcaagcccgaggtctcgctggatgac
ggcgacatcatcgacagcatgttcatgagcaagaaggccttgtgcgagttctatgaagag
cagatcgaggatgcctacaagaccggcgtgatgttctccctgcacgtcaaggcgacgatg
atgaaggtcagccatcccatcgtcttcggccacgccgtcaagaccttctaccgggacgcc
ttcgccaagcaccagaagctgttcgacgaattgggtgtcaacgtcaacaacgggttgtca
gatctctacagcaagatcgagaccctgccggcctcccagcacgatgagatcatcgacgac
ctgcatcgttgccacgagcaccgccccgagctggcgatggtggattccgcccgcggaatc
accaatttccattcccccagcgacgtcatcgtggacgcctcgatgccggcgatgatccgg
gccggcggcaagatgtacggcgccgacggaaagctcaaagacaccaaggcggtcaacccg
gagtccacgttctcgcggatctaccaagaaatcatcaacttctgcaagaccaacggacag
ttcgatccgacaacgatgggcacggtccccaacgtcggcctgatggcgcaacaggccgag
gaatacggctcacacgacaagaccttcgaggttcccgaggacggcgtcgccaacatcgtc
gaccttgacaccggcgaggtgctgctcacccaggatgtcgaggccggcgatatctggcgc
atgtgtgtggtcaaggacgcgccgatccgcgactgggtcaaactggccgtcacccgcgcc
cgcaattcgggcatgccggtgctgttctggctggacccgtaccgtccgcacgagaacgaa
ctcatcaagaaggtcaagacgtacctgaaggatcaccacaccgaaggtctggacatccag
atcatgtctcaggtgcgttccatgcggtacaccctggaacgcctgattcgcgggctggac
accattgccgcgaccggcaacattctgcgtgactatctgaccgacctgttcccaatcctg
gagctgggcaccagcgccaagatgttgtccatcgtgcccctgatggccggcggcgggatg
tatgaaaccggcgccggaggctcagcgcccaagcacgtcaagcaactggtcgaggagaat
cacctgcgctgggattcgcttggcgagttcctcgccctgggagccagcctagaagacatg
ggcatcaagatcggcaatgaccgggccaagattctggccaggactcttgatgacgcaatc
ggcaagctgctgggcaacaacaagagcccctcacgcaagaccggtgagctcgacaaccgg
ggcagccagttctatctcgccctgtactgggcccaagaacttgccgagcagaccgacgac
gcggaacttgccgaacacttcgccaagctcgccaaggcgctggccgatggcgaggaggcc
atcgtggccgaactcgccgaagcgcagggcgaggcggttgacatcggcggctactacgcg
ccggacaacgagaagacaaccgcggtcatgcggcccagcaagacgctcaacgccgcgctg
gaggccgcacagggctga

DBGET integrated database retrieval system