KEGG   Mycobacterium marinum E11: MMARE11_04670Help
Entry
MMARE11_04670     CDS       T04774                                 

Gene name
sdhB_1
Definition
(GenBank) succinate dehydrogenase (iron-sulfur subunit), SdhB_1
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00020  Citrate cycle (TCA cycle)
mmae00190  Oxidative phosphorylation
mmae00650  Butanoate metabolism
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01130  Biosynthesis of antibiotics
mmae01200  Carbon metabolism
Module
mmae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmae_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMARE11_04670 (sdhB_1)
   00650 Butanoate metabolism
    MMARE11_04670 (sdhB_1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MMARE11_04670 (sdhB_1)
Enzymes [BR:mmae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MMARE11_04670 (sdhB_1)
    1.3.5.4  fumarate reductase (quinol)
     MMARE11_04670 (sdhB_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer2 Fer4_18 Fer4_17 Fer4_9 Fer4_7 Fer4_10
Motif
Other DBs
NCBI-ProteinID: CDM74615
LinkDB All DBs
Position
complement(553592..554338)
Genome map
AA seq 248 aa AA seqDB search
MGYNASLRVWRGDESNGELRDFTVEVNEGEVVLDVIHRLQQTQTPDLAVRWNCKAGKCGS
CSAEINGKPRLMCMTRMSTFAEDEIVTVTPLRTFPVIRDLVTDVSFNYEKAREIPSFAPP
KELQPGEYRMAQVDVARSQEFRKCIECFLCQNVCHVIRDHEENKKAFAGPRFLMRIAELE
MHPLDTRDRRNEAQEAHGLGYCNITKCCTEVCPENIKITDNALIPMKERVVDRKYDPVVW
LGNKLFRR
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggttacaacgcgagcttgcgcgtgtggcgcggcgacgagagcaacggcgagctgcgc
gacttcaccgtcgaggtcaacgagggtgaagtggtgctcgatgtcatccaccgtctgcag
cagacccaaacgcccgacctggcggtgcgctggaactgcaaggccggcaagtgtggatcc
tgctcggcggagatcaacggcaagccgcgactgatgtgcatgacccgaatgtcgaccttc
gccgaagacgagatcgtcaccgtgacgccgctgcgcaccttcccggtgattcgcgacctg
gtcaccgatgtctcgttcaattacgaaaaggcacgcgagattccctctttcgcgcctccc
aaggagctgcagcctggcgagtaccggatggcccaggtcgacgtcgcgcgctcgcaggag
ttccgcaagtgcatcgagtgcttcctgtgccagaacgtctgccacgtcatccgcgaccac
gaggagaacaagaaggcgttcgccggtccgcggttcttgatgcgcatcgccgaactggaa
atgcatcccctcgacactcgggaccggcgcaacgaggcacaagaggcgcatggcctgggg
tactgcaacatcaccaagtgctgcaccgaggtatgcccggaaaacatcaagatcaccgac
aacgcactgatcccgatgaaggagcgcgtggtcgaccgcaagtacgacccggtcgtgtgg
ctgggcaacaagctgttccgacgctga

DBGET integrated database retrieval system