KEGG   Mycobacterium marinum E11: MMARE11_04680Help
Entry
MMARE11_04680     CDS       T04774                                 

Gene name
sdhA_1
Definition
(GenBank) succinate dehydrogenase (iron-sulfur subunit), SdhA_1
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00020  Citrate cycle (TCA cycle)
mmae00190  Oxidative phosphorylation
mmae00650  Butanoate metabolism
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01130  Biosynthesis of antibiotics
mmae01200  Carbon metabolism
Module
mmae_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mmae_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mmae_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MMARE11_04680 (sdhA_1)
   00650 Butanoate metabolism
    MMARE11_04680 (sdhA_1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    MMARE11_04680 (sdhA_1)
Enzymes [BR:mmae01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     MMARE11_04680 (sdhA_1)
    1.3.5.4  fumarate reductase (quinol)
     MMARE11_04680 (sdhA_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 GIDA AAA_lid_2 Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CDM74616
LinkDB All DBs
Position
complement(554338..556266)
Genome map
AA seq 642 aa AA seqDB search
MVEVERHSYDVVVIGAGGAGLRAVIEARERGLKVAVVCKSLFGKAHTVMAEGGCAAAMGN
SNPKDNWKTHFGDTMRGGKFLNNWRMAELHAKEAPDRVWELETYGALFDRLKDGKISQRN
FGGHTYPRLAHVGDRTGLELIRTMQQKIVSLQQEDFAEVGDYEARIKVFAECTITELLKD
GPENGGRIAGAFGYWRESGRFILFEAPAVVMATGGIGKSFKVTSNSWEYTGDGHALALRA
GATLINMEFVQFHPTGMVWPPSVKGILVTEGVRGDGGVLKNSDDDRFMFGYIPPVFKGQY
AETAEEADQWLKDNDSARRTPDLLPRDEVARAINSEVKAGRGTPHGGVYLDIASRLTPEE
IKRRLPSMYHQFMELAGVDITKEPMEVGPTCHYVMGGIEVDADTGAATVPGLFAAGECSG
GMHGSNRLGGNSLSDLLVFGRRAGLGAADYVRALSSRPTVSPESVDAAARLALAPFEGPT
DGTAPENPYALQMDLQFLMNDLVGIIRNADEISKALTLLRELWARYEHVQVEGHRQYNPG
WNLAIDMRNMLTVSECVARAALERTESRGGHTRDDHPGMDPNWRNVLLVCRAAQEATDGS
HITITRQPQVPMRPDLLDLFQISELEKYYTAEELADHPGRRT
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggtcgaacggcactcctacgacgttgtcgtgatcggtgccggcggcgcgggg
ctgcgggcggtcatcgaggcacgcgagcgcggcctgaaagtagcggtcgtgtgcaaatcg
ctgttcggcaaggcccacacggtgatggccgagggtggctgcgcggccgcgatgggtaac
agcaaccccaaagacaactggaagacccacttcggcgacaccatgcgaggcgggaagttc
ctcaacaactggcgcatggccgaactgcacgccaaggaagccccggaccgggtctgggag
ctcgaaacctacggcgcgctgttcgaccgcctcaaagacggcaagatcagccagcgcaac
ttcggtgggcacacctatccgcggctggcccacgtcggtgaccgcaccggcctggagttg
atccgcaccatgcaacagaagatcgtgtcgctgcagcaggaggacttcgccgaggtcggc
gactatgaggctcggatcaaggtgttcgccgaatgcacgatcaccgagctactcaaagac
ggtcccgaaaacggcgggcggatcgccggagccttcggctactggcgggaaagcggccgc
ttcatcctgttcgaggcgcccgccgtggtgatggccaccggcgggatcggcaagtccttc
aaggtcacgtccaactcctgggagtacaccggcgacgggcatgccctggcactgcgggcc
ggcgcgacgttgatcaacatggagttcgttcagttccacccgaccggcatggtgtggccg
cccagtgtgaaggggatcctggtcaccgaaggtgttcgcggtgacggcggggtgctcaag
aactccgatgacgatcgattcatgttcggttacatcccgccggtgttcaaaggccaatac
gcggagaccgccgaagaagccgaccagtggctcaaagacaacgactcggcccgtcgcacc
cctgacctgttgccgcgagacgaggtggcccgcgccatcaactccgaggtcaaggcgggc
cggggcaccccgcacggcggcgtctacctcgacatcgcgtcgcggctgactcccgaggag
atcaagcgccggctgccgtcgatgtatcaccagttcatggagctggccggggtcgacatc
accaaggagccgatggaagtcgggccgacctgccactacgtgatgggcggcatcgaggtc
gacgccgacacgggcgcggccacggtccccgggctgttcgccgccggcgagtgctcgggc
ggcatgcacggctccaaccggctgggcgggaactcgctgtccgacctgctggtcttcggt
cggcgggccggcctgggcgccgccgactacgtgcgcgcgctgagcagccgtccgaccgtc
tcaccggagtccgtcgacgccgccgccaggctggccctggcgccgttcgaagggcccacc
gacggcaccgctccggaaaacccgtacgcgctgcagatggacctgcagttcctgatgaac
gacctggtcggcatcatccgcaacgccgacgagatcagcaaagcgttgaccctgttacgg
gagctgtgggcacgctacgagcatgtgcaggtcgaaggccaccgccagtacaacccgggc
tggaacctcgcgatcgacatgcgcaacatgctgaccgtcagcgagtgtgtggctcgggcc
gcgctggaacgcaccgagagccggggcgggcacacccgcgacgaccatcccggcatggac
ccgaactggcgcaacgtcttgttggtctgccgggccgcccaggaagccaccgacggttcc
cacatcaccatcacccgccagccgcaggtaccaatgcggccggacctgctggacctcttc
cagatttccgagctggagaagtactacaccgccgaagagttggccgaccatccaggacgg
agaacgtaa

DBGET integrated database retrieval system