KEGG   Mycobacterium marinum E11: MMARE11_05680Help
Entry
MMARE11_05680     CDS       T04774                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00220  Arginine biosynthesis
mmae00250  Alanine, aspartate and glutamate metabolism
mmae00290  Valine, leucine and isoleucine biosynthesis
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01130  Biosynthesis of antibiotics
mmae01210  2-Oxocarboxylic acid metabolism
mmae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmae00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMARE11_05680
   00290 Valine, leucine and isoleucine biosynthesis
    MMARE11_05680
   00220 Arginine biosynthesis
    MMARE11_05680
Enzymes [BR:mmae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     MMARE11_05680
    2.6.1.66  valine---pyruvate transaminase
     MMARE11_05680
Amino acid related enzymes [BR:mmae01007]
 Aminotransferase (transaminase)
  Class I
   MMARE11_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CDM74716
LinkDB All DBs
Position
complement(670381..671652)
Genome map
AA seq 423 aa AA seqDB search
MVDVTTHQLPWHASSHQRQRSFAQSSKLQDVLYEIRGPVHQQAARLETEGHRILKLNIGN
PAPFGFEAPDVIMRDMIQALPYAQGYSDSQGILPARRAVVTRYELVDGFPRFDVDDVYLG
NGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTSLAGGTPVHYLCDETQDWQPDIADL
ESKITERTKALVIINPNNPTGAVYSHEILTQMVELARKHQLLLLADEIYDKILYDDAKHI
SVATLAPDMLCLTFNGLSKAYRVAGYRAGWLAITGPKEHASSFIEGISLLANMRLCPNVP
AQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAWSKLNEIPGVSCVKPKGALYAFPRLDPE
VYDIADDEQLVLDLLLSEKILVTQGTGFNWPEPDHLRLVTLPWSRDLAAAIERLGNFLVS
YRQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgtgaccactcaccagctgccctggcacgcctccagccaccagcgccagcgt
tccttcgcgcagtcgtccaagcttcaggacgtcctgtacgaaatccgcggtccggtgcac
cagcaggccgcgcggctggagaccgaagggcatcggatcctcaagctcaacatcggcaac
cccgcgccgtttggcttcgaggcgccggacgtgatcatgcgcgacatgatccaggcgctg
ccctatgcgcaggggtactccgactcgcaagggatcctgccggcccgacgtgccgtggtc
acccgctacgagctcgtcgacggctttccccgattcgacgtcgacgatgtctacctgggc
aacggtgtctccgagctgatcaccatgacgctgcaggccttgctcgacaacggcgaccag
gtgctgattcccgcacccgactatcccctgtggacggcgtcgacctcgttggccggcggc
actccggtgcattacctatgcgacgagacgcaggactggcagcccgacatcgccgacctg
gagtccaagatcaccgagcgcaccaaggcgctggtgatcatcaaccccaacaaccccacc
ggcgcggtctacagccacgaaatcctcacccagatggtggagctggcccgcaagcatcaa
ctgttgctgctcgccgacgagatctacgacaagatcctctacgacgacgccaagcacatc
agcgtggccacgctcgccccggacatgctgtgcctgaccttcaatggcctgtccaaggcc
taccgcgttgccggataccgggcgggctggctggcgatcaccggtcccaaggagcacgcc
agcagcttcatcgagggaatcagcctgctggccaacatgcgcttgtgcccgaacgtcccg
gcccagcatgcgatccaggtcgccctgggcggccaccaaagcatcgatgatctggtgctc
cccggcggtcgtctgctcgaacagcgtgacgtcgcctggtccaagctcaacgaaattccc
ggggtgtcctgcgtcaagcccaagggtgcgctgtatgcgtttccccggctggacccggag
gtctacgacatcgccgacgacgaacaactcgtgctcgatctgctgctgtccgagaagatc
ctggtcacccaggggaccgggttcaattggccggaaccggatcacctgcgcctggtgacc
ttgccgtggtcgcgtgatctggcggcggccatcgagcgcctgggcaacttcctggtcagc
taccggcagtag

DBGET integrated database retrieval system