KEGG   Mycobacterium marinum E11: MMARE11_12740Help
Entry
MMARE11_12740     CDS       T04774                                 

Definition
(GenBank) conserved protein
  KO
K07228  TrkA domain protein
Organism
mmae  Mycobacterium marinum E11
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    MMARE11_12740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkA_C
Motif
Other DBs
NCBI-ProteinID: CDM75422
LinkDB All DBs
Position
1541217..1541699
Genome map
AA seq 160 aa AA seqDB search
MDVKEVLLPGVGLRYEFTSQKGERIGIIARRTGDFEVVVYAANDPDAARPVFCLTDEEAD
ALAQILGAPRIAERFTELTREVPGLEAGHIIIAPQSPFVDRPLGETHARTRTGASIVAIV
RGQEVVASPNPAELLRERDVLIVIGTEEGIAGVEQIVDKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcaaggaggtgctgctgcctggcgtcggtctccgctacgagttcactagccag
aaaggcgagcggatcggcattattgcccggcgcaccggcgatttcgaggtcgtcgtatac
gccgccaacgacccggatgcggcgcggccggtcttctgcctgaccgatgaagaggctgat
gcgttggctcagatcctgggtgcaccacggatcgccgagcggttcaccgagctgacccgt
gaggtgcccgggctcgaggcgggccacatcatcatcgcgccacagagcccgttcgttgac
cggccgctcggggagacccatgcccgcacccgcaccggcgcgtcgatcgtggcaatcgtg
cgtggccaagaggtggtcgcatcgccgaacccggcggagctgttgcgcgagcgcgacgtt
cttatcgtgatcggtaccgaagagggcattgccggagtcgagcagatcgtcgacaagggc
tga

DBGET integrated database retrieval system