KEGG   Mycobacterium marinum E11: MMARE11_16140Help
Entry
MMARE11_16140     CDS       T04774                                 

Definition
(GenBank) methyltransferase
Organism
mmae  Mycobacterium marinum E11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM B12-binding
Motif
Other DBs
NCBI-ProteinID: CDM75762
LinkDB All DBs
Position
1920512..1922008
Genome map
AA seq 498 aa AA seqDB search
MTILLVNPPGARRNGRSYLSEQKLGDPWVYSTMPMEHLGMMSIKAYAKTQGIEIATVNGL
VAGHSSVQETWSAIENAVRCSGKPRLVGFSCIDTLPEVLWLAQRVRETWDDVQIALGNAI
ATLNYERILRQHDCFDFVIVGDAEVGFTKLANAVANGAALDDVPGLARRDDRGQIICSPS
RLIDLDELPRPARDELPSVLADGFSAAVFSTRGCPYRCTFCGTGAMSAMLGRNSYRAKSV
DAVVDEIAYLKSDFDIGFLCITDDLFISKHPSSQQRAAEFADAMINSGVDVKFMMDIRLD
SVVDLELFKHLHKAGLRRVFVGLETGSYDQLRAYRKQIINRGQDAADTINALQQVGVDVI
PGTIMFHPTVQPDELRETARLLRATKFISTYKFMGKITPYPGTPLYQEYSDLGYLREEWP
LGEWDFVDPEAARVYADVCSLIAPRPDLPYDEAEKFFLARLDEWDDVIAARIEQTAADGT
GTLEAPGDPQTPELLSLT
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatattgcttgtcaatcctcccggtgcccgccgtaatgggcgctcctatttgagc
gagcagaagcttggcgacccgtgggtgtattccaccatgccgatggagcacctcggcatg
atgtcgatcaaggcttacgccaagacccaggggatcgagattgccaccgtcaacgggctc
gttgccgggcacagttcggtacaggaaacgtggtcggccatcgagaacgccgtgcgttgc
agcggtaagccccggctggtcggcttttcgtgcatcgacacccttcctgaggtgctgtgg
ctagcgcagcgcgtccgcgagacctgggacgacgtgcagatcgccctgggaaatgcgatc
gcgacattgaattacgagcggattttgcgccagcatgactgctttgacttcgtgatcgtt
ggagacgccgaggtcggattcaccaagctcgccaatgccgtggccaatggcgctgcgctc
gacgacgttcccgggttggcccgccgggacgatcgcgggcagatcatctgctcgccgtcg
cgcctgatcgacctcgacgagctgccccgtccggcccgcgacgagttgccgagcgttctt
gccgatggcttttccgccgcggtcttttcgacccgtggctgcccctaccgctgcacgttc
tgcggcaccggagccatgtcggcgatgctcgggcgcaacagctaccgggccaagtcggtt
gacgcggtggtcgacgagatcgcgtacctgaaatccgatttcgacattggctttctctgc
atcaccgacgacctgttcatctccaagcatcccagctcgcaacaacgcgcggccgagttt
gctgacgccatgatcaacagcggcgttgacgtcaagttcatgatggatatccgcctggac
tccgtggtggatctagaactgttcaaacacctgcacaaagcgggtttgcgccgggttttc
gtcggcttggaaaccggttcttatgatcaactccgcgcgtaccgcaaacagatcatcaat
cgcggacaagatgccgccgacacgatcaacgcactgcagcaggtgggcgttgacgtaata
ccgggcaccatcatgtttcatcccacggtgcagccggatgaattgcgcgagaccgcgcgg
ctgctacgggccacaaaattcatctccacctataagttcatgggcaagatcaccccgtat
ccgggaacacccctataccaggagtattcggatctgggctatctacgcgaggaatggccg
ctgggtgaatgggatttcgtggacccggaggccgcgcgtgtttatgccgatgtctgttcg
ctcatcgcgccacgcccggacctgccctacgacgaggccgagaagttcttcctggcgcgc
cttgacgaatgggacgacgtcatcgccgcccgaattgagcaaacggcagccgacggcacc
ggcactctcgaggctcccggcgacccgcagacgccggaactgctgtcgttgacctag

DBGET integrated database retrieval system