KEGG   Mycobacterium marinum E11: MMARE11_16520Help
Entry
MMARE11_16520     CDS       T04774                                 

Gene name
ddlA
Definition
(GenBank) d-alanine--D-alanine ligase DdlA
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00473  D-Alanine metabolism
mmae00550  Peptidoglycan biosynthesis
mmae01100  Metabolic pathways
mmae01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MMARE11_16520 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MMARE11_16520 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MMARE11_16520 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mmae01011]
    MMARE11_16520 (ddlA)
Enzymes [BR:mmae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MMARE11_16520 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:mmae01011]
 Precursor biosynthesis
  Amino acid ligase
   MMARE11_16520 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 ATP-grasp_4 RimK CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: CDM75800
LinkDB All DBs
Position
1965793..1966914
Genome map
AA seq 373 aa AA seqDB search
MSGSSRRGERLRVAVVFGGRSNEHAISCVSAGSILRNLDPRRFEVIAIGITPQGSWVLTD
GNPDALAITDRRLPEVSSQSGTELALPADPRWGGQLVSLPPGAGEVLASVDVVFPVLHGP
YGEDGTIQGLLELAGVPYVGAGVLASAAGMDKEFTKKLWSAAGLPIGPHAVLRPSRQSLD
REELQRLGLPAYVKPARGGSSIGVSRVSSFDELPAAIAAARRHDPKVIVEAAINGRELEC
GVLEFPDGRLEASTLGEIRVAGVRGREDGFYDFETKYLDDAAELDVPAKVEDDVADAVRQ
LAIRAFEAIDCQGLARVDFFLTDDGPVINEINTMPGFTTISMYPRMWAASGVDYPTLLAT
MVETALARGIGLR
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggcagcagccggcgtggcgaacgtctccgggttgccgtcgtgttcggcggacgc
agcaacgagcatgcgatctcatgcgtgtctgcgggcagcattctgcgcaatcttgacccg
cgacgcttcgaggtgatcgcgatcgggatcaccccgcaaggctcgtgggtgctcaccgac
ggcaacccggatgcgctggcaatcaccgaccggcggctacccgaggtgagctcgcagtcc
ggcaccgagctggctttgccggcagatccgcgctggggcggccaactggtctcgttgccg
cccggtgccggagaggtgctggcctcggtcgacgtggtgtttcccgtgctgcatggaccg
tacggcgaggacggaacgatccagggactactcgaactcgccggcgttccctatgtcggc
gccggggtgctggccagcgcggccggtatggacaaagagttcaccaagaaactgtggagt
gcggcggggctaccgatcggcccgcatgccgtgctgcgcccatcgcgacaatcgctggac
cgcgaggaactgcagcggctggggttgccggcttacgtcaaacccgcgcgcggcggctcc
tcgatcggtgtcagccgggtctcgagcttcgatgagctgcccgccgcgatcgccgccgcc
cggcgacacgatccgaaggtgatcgtcgaggccgcgatcaacggtcgcgagctggagtgc
ggcgtgctcgagttccccgacggcagattggaagccagcaccctgggagagatccgggtg
gccggggtgcgtggacgcgaagacggtttctatgactttgagaccaaatacctcgacgac
gctgccgaattggacgtgccggccaaggtcgaagacgacgtcgctgacgcggtgcgccag
ctggcgattcgcgctttcgaggccatcgactgccaaggcctggcccgagtcgacttcttc
ctcaccgacgacggcccggtgatcaacgagatcaacacgatgccggggttcaccacgatc
tcgatgtacccgcggatgtgggcggccagcggggtcgactatcccaccttgctggccacc
atggtggagaccgcgttggcgcggggcatcggcctgcgctaa

DBGET integrated database retrieval system