KEGG   Mycobacterium marinum E11: MMARE11_20590Help
Entry
MMARE11_20590     CDS       T04774                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase GabT
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00250  Alanine, aspartate and glutamate metabolism
mmae00280  Valine, leucine and isoleucine degradation
mmae00410  beta-Alanine metabolism
mmae00640  Propanoate metabolism
mmae00650  Butanoate metabolism
mmae01100  Metabolic pathways
mmae01120  Microbial metabolism in diverse environments
Module
mmae_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mmae00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MMARE11_20590 (gabT)
   00650 Butanoate metabolism
    MMARE11_20590 (gabT)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MMARE11_20590 (gabT)
   00280 Valine, leucine and isoleucine degradation
    MMARE11_20590 (gabT)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MMARE11_20590 (gabT)
Enzymes [BR:mmae01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     MMARE11_20590 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     MMARE11_20590 (gabT)
Amino acid related enzymes [BR:mmae01007]
 Aminotransferase (transaminase)
  Class III
   MMARE11_20590 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CDM76206
LinkDB All DBs
Structure
PDB: 

Position
complement(2438177..2439517)
Genome map
AA seq 446 aa AA seqDB search
MASLDQSRLLVTEIPGPASLELNKRRAAAVSGGVGVTLPVFVVRAGGGIVEDADGNRLID
LGSGIAVTTIGNAAPRVVDAVRAQVEQFTHTCFMVTPYEQYVAVAEELNRITPGSGEKRT
VLFNSGAEAVENSIKVARAHTRKQAVAAFDYAYHGRTNLTMALTAKSMPYKSGFGPFAPE
IYRAPVSYPYRDNLLDKDIATDGELAAERAINLIDKQIGAANLAAVIIEPIAGEGGFIVP
ADGFLPALQRWCRDNDVVFIADEVQTGFARTGAMFACDHENVEPDLIVTAKGIADGFPLS
AVTGRAEIMDAPHTSGLGGTFGGNPVACAAALATIETIEREGMVERARQIERLVMDRLLR
LQAADDRLGDVRGRGAMIAMELVKSGTAEPDAALTQKLAAAAHAAGVIVLTCGMFGNVIR
LLPPLTISDELLSEGLDILCQILADL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtggccagcctcgatcaaagtcgtctcttggtcaccgaaatccccggccccgcatcgttg
gagctcaacaagcgccgggccgcggcggtgtcgggtggcgtcggggtcaccctgccggtg
ttcgtggttcgcgcgggtggcggaatcgtggaggacgccgacggcaaccggctgatcgac
ctcggctccggcatcgccgtcacgactatcggcaatgcggcgccccgcgtcgtggacgcg
gtacgggcccaggtggagcagttcacccacacctgcttcatggtgaccccttacgagcaa
tacgtggccgtcgccgaagagctcaatcggatcaccccgggctccggcgagaaacggacg
gtgctgttcaactccggcgccgaggcggtggagaactccatcaaggtcgcccgcgcacac
acccgcaagcaggccgtggccgcgttcgactatgcctaccacggccgcaccaacctgacg
atggccctgaccgccaagtccatgccgtacaagagcggcttcggcccctttgcgccggag
atctaccgcgcaccggtgtcctacccctaccgcgacaacctgctcgacaaagacatcgcc
accgacggtgaacttgccgccgaacgcgccatcaacctcatcgacaagcagatcggcgcc
gccaacctggccgcggtcatcatcgaaccgatcgcgggcgagggcggcttcatcgttccg
gccgacggtttcctgcccgcgctgcagcggtggtgccgcgacaacgacgtggtgttcatc
gccgacgaggtgcagaccggatttgcccgcaccggcgccatgttcgcgtgcgaccacgag
aacgtcgagcccgacctgatcgtcaccgccaaaggcatcgccgacggattccccctgtcc
gcggtcaccggccgggccgagatcatggacgccccgcacaccagcggcttgggcggcacc
ttcgggggcaacccggtcgcatgtgcggcggccctggccaccatcgaaacgatcgaacgc
gaaggcatggtcgaacgggcccgccagatcgaacgactggtgatggaccgattgctgcga
ttgcaagccgccgatgaccgcctcggcgatgtgcgcggccgcggcgccatgatcgccatg
gagctggtgaaatcgggcaccgccgaacccgacgctgcactcacccaaaagctggccgcc
gccgcccatgccgccggcgtaattgtcttgacgtgcggaatgttcggcaacgtgatccgg
ctgctgcccccgctgacgatcagcgacgagctgctgtccgaaggcctcgacatcctgtgc
cagatcctggccgacctctga

DBGET integrated database retrieval system