KEGG   Mycobacterium marinum E11: MMARE11_24670Help
Entry
MMARE11_24670     CDS       T04774                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
mmae  Mycobacterium marinum E11
Pathway
mmae00010  Glycolysis / Gluconeogenesis
mmae00052  Galactose metabolism
mmae01100  Metabolic pathways
mmae01110  Biosynthesis of secondary metabolites
mmae01120  Microbial metabolism in diverse environments
mmae01130  Biosynthesis of antibiotics
Module
mmae_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mmae00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MMARE11_24670
   00052 Galactose metabolism
    MMARE11_24670
Enzymes [BR:mmae01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     MMARE11_24670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim DPPIV_rep
Motif
Other DBs
NCBI-ProteinID: CDM76614
LinkDB All DBs
Position
2955525..2956676
Genome map
AA seq 383 aa AA seqDB search
MAGLAACSNTAINSPTGRGNASTPAGPPSITSEPFGEVDATPVSRYTLNSGHGMRVRILT
YGGIIQSIEVPDRTGRIGNVVLGFPTLAGYLNNTGSAKTYFGAIIGRYGNRIAGGVFSLD
GHEYHLPINDGGNSLHGGTAGFDTKVWQASVEKGGDSVGLKLHYVSPAGEMGFPGALSTT
VTYTLDQNNRLRVNYHASTDAPTVINLTNHSYFNLAGEDALDVYSHKVTIHADNYTPIDS
TLIPTGQITAVRGTPFDFTSPTAIGAHITDNDPQLLLAHGYDHNWVINRANNTELIEAAR
VQDPQTGRTLTVSTTEPGVQFYTSNFINATFTGTSGHIYRQGAGFTMETQHYPDSPNHPG
FPSTELVPGQTYDSTTVFGFGAE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtggcgggcttggcggcgtgcagcaacacggcaatcaactcgcccacggggcgcggcaat
gcatcgacgcccgcggggccgccgtcgatcaccagcgagccgttcggtgaggtcgatgcg
accccggtgagccgctacacgctcaacagcgggcacggaatgcgagtgcgaatcctgact
tacggcggcatcatccagtcgatcgaagtccccgatcgaaccggacgtatcggcaacgtg
gtgctgggctttccgaccctggccggctacctgaacaacaccggatccgccaaaacctat
ttcggcgcgatcatcggccgctacggcaaccggatcgccgggggagtcttctcgctcgac
ggccacgagtatcacctgcccatcaacgacggcggtaacagcctgcacggcggcaccgcc
ggattcgataccaaggtgtggcaggccagcgtggaaaaaggcggcgacagcgtgggcctg
aagctccactatgtcagtcccgcgggagaaatgggttttcccggggcgctgagcaccacg
gtcacatacaccctggatcagaacaatcgactgcgcgtcaattaccacgccagcaccgat
gcgccgaccgtgatcaacctgaccaatcacagctacttcaacctggccggtgaggacgca
cttgacgtctacagccacaaggtcaccatccatgccgacaactacacgccaatcgactcc
accctgatcccgaccgggcagatcaccgcggtgcggggcacgccgttcgatttcacctca
ccgaccgcgatcggcgcgcacatcaccgacaatgacccgcaattgttgctggcccacggc
tatgaccacaactgggtgatcaaccgcgccaacaacaccgaactgatcgaggcggcccgg
gtgcaggatccacaaacggggcgcaccctgaccgtctccaccaccgagcccggcgtgcag
ttctacacatccaacttcatcaacgcgacgttcaccggcaccagcgggcatatctaccgc
caaggcgcgggattcacgatggagacccagcactacccggattcgccgaatcaccccggc
ttcccgagcaccgagctcgttccgggacagacctacgattcgacaacggttttcggcttc
ggcgccgaatag

DBGET integrated database retrieval system