KEGG   Mycobacterium marinum E11: MMARE11_34460Help
Entry
MMARE11_34460     CDS       T04774                                 

Definition
(GenBank) dehydrogenase
Organism
mmae  Mycobacterium marinum E11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 AlaDh_PNT_C Glu_dehyd_C Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: CDM77587
LinkDB All DBs
Position
4179962..4180972
Genome map
AA seq 336 aa AA seqDB search
MRSAVVTTPGHTDVIEAPDPQVGPKDVLVKIRACGICGTDSFYISIGGLPPHRGRMPLGH
EPAGEVVAVGSRVSGLAVGDHVVINPMAAPNGIIGNGGASGALADYLLIEEAVRGVSLEV
IPEHIPFEVAALNEPMAVARHAVNQCKPKPSDKILIFGAGPIGLGAVLAFKSVGAAHVAV
ADLIPSRLDKALQVGADAVINSAEEDLTQRLIDLHGPGQALFPGKAGTDIYLDAAGAPAA
VNSALTNAKKGATIGIVAVHKKPVEVDLVTVMSHEITLVGSIGYPTEIFDVTKDIVADWQ
RYALIVDRTIAFDNVQDALAAATAPGTADKIVVTFP
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaggtccgctgtggtgacgaccccgggccacaccgacgtcatcgaggcacccgacccg
caggtcgggcccaaagacgtgttggtcaagatccgcgcctgcggaatctgcggcaccgat
tcgttctacatctcgatcggtggcctaccgccccatcgaggccggatgccgctcgggcac
gaacccgccggcgaggtggtcgcggtcggctcgcgggtatctggcctcgccgtcggtgac
cacgtcgtcatcaatccgatggccgcccccaacggcatcatcggcaacggcggagccagt
ggcgcgctggcggactatctcctcatcgaggaggcggtgcgcggggtaagcctggaggtc
attcccgagcacataccgttcgaagtggccgcgctcaacgagccgatggcggtggcccgc
catgctgtaaaccaatgcaagccaaagccttctgacaagatcctgatcttcggtgccggc
ccaatcggtctgggcgcggtgctggcgttcaagtcggtcggcgccgcgcacgtcgcggtc
gctgatctcatcccgtcccgcctggacaaggcgctccaagtgggtgccgacgcggtcatc
aattccgccgaggaagatctcacccaacggctcatcgatctgcacggtcctgggcaggca
ctgttccctggcaaggcgggcaccgatatctacctggacgccgccggcgcgcccgcggcc
gtcaacagcgcgctgaccaacgcgaaaaagggggccaccatcggcatcgtggccgtccac
aagaagccggtcgaggtcgatctggtcaccgtgatgagccacgagatcaccctggtggga
tcgatcggctaccccaccgaaatcttcgacgtcaccaaagacatcgtcgccgattggcag
agatatgcattgatcgtcgaccgcaccatcgcattcgacaacgtgcaggatgcccttgcc
gccgccaccgcaccgggaacggccgataagatcgttgtgactttcccctag

DBGET integrated database retrieval system