KEGG   Mycobacterium marinum E11: MMARE11_42040Help
Entry
MMARE11_42040     CDS       T04774                                 

Definition
(GenBank) conserved protein
Organism
mmae  Mycobacterium marinum E11
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3504
Motif
Other DBs
NCBI-ProteinID: CDM78341
LinkDB All DBs
Position
complement(5101010..5101309)
Genome map
AA seq 99 aa AA seqDB search
MNQFLLTVIADDAPRNTGPDFGKASPLGLLVVVVLVIATLFLLRSMNRQLRKVPESFDRA
HPEPDQAADEGTDVVDVEEPPAADGGATTRSPGPADDPG
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagtttctgctcactgtgattgcagacgatgcaccgcgcaataccggacccgat
ttcggcaaggccagtccgttggggctgctcgtcgtcgtggtcttggtcatcgccacgttg
tttctgctgcgatcgatgaaccggcaactcaggaaggtcccggaatcctttgatcgtgcg
caccccgagccggatcaggcggccgacgagggcacggatgtggtggacgtcgaggaaccg
cccgccgcggacggtggcgcaaccacgcgatcgccggggccggccgatgaccccggctga

DBGET integrated database retrieval system